KEGG   Agrobacterium tumefaciens Ach5: Ach5_23250
Entry
Ach5_23250        CDS       T03816                                 
Name
(GenBank) iron complex transport system ATP-binding protein
  KO
K10834  heme transport system ATP-binding protein [EC:7.6.2.5]
Organism
atf  Agrobacterium tumefaciens Ach5
Brite
KEGG Orthology (KO) [BR:atf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:atf02000]
    Ach5_23250
Enzymes [BR:atf01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.5  ABC-type heme transporter
     Ach5_23250
Transporters [BR:atf02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Heme transporter
    Ach5_23250
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_13 AAA_15 AAA_23 SMC_N RsgA_GTPase AAA_29 AAA_30 AAA_27 SbcC_Walker_B ORC-CDC6-like Rad17 DUF6885 AAA_28 ATPase_2 MMR_HSR1 AAA_16 AAA_14 AAA_22 AAA nSTAND3 cobW TsaE AAA_33 RNA_helicase AAA_18
Other DBs
NCBI-ProteinID: AKC08100
LinkDB
Position
circular:complement(2382009..2382791)
AA seq 260 aa
MIRAENLTLIRSGRRLLDEVCVDLKPGKVNVIIGPNGAGKSTLMKVLSGEMRAEAGSVTY
NDVALPLFTPVQLARIRAVLPQHTQLAFPFTALEIVRMGAVAQGSRAPEEQARRALARAG
LRGFEQRSYNMLSGGEQQRVQFARALAQVPHPVENGEVRALFLDEPTASLDIGHQIAVLE
TARDFAIGGGLVLAILHDLNLAAEFADQLIVMHGGRVTASGPSLDTISDETIARVYGIGG
VVGRLPARHIPYVLPQSRHR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgatccgggccgaaaacctcaccctcatccgctccggccgccgtctgctcgacgaggtc
tgcgtcgatctgaagcccggcaaggtcaatgtcattatcggtccgaacggtgccggcaaa
tcgacgctgatgaaggttctgtccggcgagatgcgcgccgaggccggttcagtgacctat
aatgatgttgccctgccgttgtttacgccggttcaacttgcgcgcatccgcgccgtgctg
ccgcagcatacccagcttgcctttcctttcaccgcgctcgaaatcgtgcgcatgggcgct
gtcgcgcaagggtcgcgcgcgccggaagagcaggcccgccgggcgctcgccagggccggg
cttcgcgggttcgagcagcgctcctacaacatgctgtctggcggcgagcagcagcgcgtg
caatttgcccgcgctctcgcccaggtgccgcatcccgtggaaaacggcgaggtgcgggct
ctctttctcgatgagccaacggccagtctcgatatcggccaccagatcgcggtgctggaa
acggcgcgggatttcgctattggcggcggtctcgtgcttgccatcctgcacgatctcaac
cttgcggcagaatttgccgatcaacttatcgtcatgcatggcggtcgggtaacggcgagc
ggtccatcgctggacacgatcagcgacgagacgattgcaagggtctatggcattggcggc
gtcgtcggacgtctgccggcgcggcatattccttatgtgctgccgcagtcgaggcatcgc
tag

DBGET integrated database retrieval system