KEGG   Arabidopsis thaliana (thale cress): AT1G01060
Entry
AT1G01060         CDS       T00041                                 

Symbol
LHY
Name
(RefSeq) Homeodomain-like superfamily protein
  KO
K12133  MYB-related transcription factor LHY
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G01060 (LHY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT1G01060 (LHY)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    AT1G01060 (LHY)
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_7 Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 839341
NCBI-ProteinID: NP_001320627
TAIR: AT1G01060
UniProt: Q6R0H1 A0A178W761
LinkDB
Position
1:complement(33365..37871)
AA seq 645 aa
MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQ
IRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPYPRKPGNNGTSSSQVSS
AKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCSGVSTVNKYPLPTKQVSG
DIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHFHADIVNGNIAKCPQNHPS
GMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPACHSQDDYRSFLQISSTFSNL
IMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSSPPSITAIAAATVAAATAWWA
SHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPFEKQNTALQDQNLASKSPASS
SDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQKKNLVDRSSCGSNTPSGSDAE
TDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDNNSNNNATTDSWKEVSEEGRIAFQ
ALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFKSQDSCAADQEGVVMIGVGTCKSL
KTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKRLRLEGEAST
NT seq 1938 nt   +upstreamnt  +downstreamnt
atggatactaatacatctggagaagaattattagctaaggcaagaaagccatatacaata
acaaagcagcgagagcgatggactgaggatgagcatgagaggtttctagaagccttgagg
ctttatggaagagcttggcaacgaattgaagaacatattgggacaaagactgctgttcag
atcagaagtcatgcacaaaagttcttcacaaagttggagaaagaggctgaagttaaaggc
atccctgtttgccaagctttggacatagaaattccgcctcctcgtcctaaacgaaaaccc
aatactccttatcctcgaaagcctgggaacaacggtacatcttcctctcaagtatcatca
gcaaaagatgcaaaacttgtttcatcggcctcttcttcacagttgaatcaggcgttcttg
gatttggaaaaaatgccgttctctgagaaaacatcaactggaaaagaaaatcaagatgag
aattgctcgggtgtttctactgtgaacaagtatcccttaccaacgaaacaggtaagtggc
gacattgaaacaagtaagacctcaactgtggacaacgcggttcaagatgttcccaagaag
aacaaagacaaagatggtaacgatggtactactgtgcacagcatgcaaaactacccttgg
catttccacgcagatattgtgaacgggaatatagcaaaatgccctcaaaatcatccctca
ggtatggtatctcaagacttcatgtttcatcctatgagagaagaaactcacgggcacgca
aatcttcaagctacaacagcatctgctactactacagcttctcatcaagcgtttccagct
tgtcattcacaggatgattaccgttcgtttctccagatatcatctactttctccaatctt
attatgtcaactctcctacagaatcctgcagctcatgctgcagctacattcgctgcttcg
gtctggccttatgcgagtgtcgggaattctggtgattcatcaaccccaatgagctcttct
cctccaagtataactgccattgccgctgctacagtagctgctgcaactgcttggtgggct
tctcatggacttcttcctgtatgcgctccagctccaataacatgtgttccattctcaact
gttgcagttccaactccagcaatgactgaaatggataccgttgaaaatactcaaccgttt
gagaaacaaaacacagctctgcaagatcaaaacttggcttcgaaatctccagcttcatca
tctgatgattcagatgagactggagtaaccaagctaaatgccgactcaaaaaccaatgat
gataaaattgaggaggttgttgttactgccgctgtgcatgactcaaacactgcccagaag
aaaaatcttgtggaccgctcatcctgtggctcaaatacaccttcagggagtgacgcagaa
actgatgcattagataaaatggagaaagataaagaggatgtgaaggagacagatgagaat
cagccagatgttattgagttaaataaccgtaagattaaaatgagagacaacaacagcaac
aacaatgcaactactgattcgtggaaggaagtctccgaagagggtcgtatagcgtttcag
gctctctttgcaagagaaagattgcctcaaagcttttcgcctcctcaagtggcagagaat
gtgaatagaaaacaaagtgacacgtcaatgccattggctcctaatttcaaaagccaggat
tcttgtgctgcagaccaagaaggagtagtaatgatcggtgttggaacatgcaagagtctt
aaaacgagacagacaggatttaagccatacaagagatgttcaatggaagtgaaagagagc
caagttgggaacataaacaatcaaagtgatgaaaaagtctgcaaaaggcttcgattggaa
ggagaagcttctacatga

DBGET integrated database retrieval system