KEGG   Arabidopsis thaliana (thale cress): AT1G09570
Entry
AT1G09570         CDS       T00041                                 
Symbol
PHYA
Name
(RefSeq) phytochrome A
  KO
K12120  phytochrome A
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G09570 (PHYA)
SSDB
Motif
Pfam: PHY PAS PAS_2 GAF HATPase_c PAS_9 PAS_4 PAS_8 HisKA
Other DBs
NCBI-GeneID: 837483
NCBI-ProteinID: NP_001322909
TAIR: AT1G09570
UniProt: P14712 A0A178W883
LinkDB
Position
1:complement(3095160..3100819)
AA seq 1122 aa
MSGSRPTQSSEGSRRSRHSARIIAQTTVDAKLHADFEESGSSFDYSTSVRVTGPVVENQP
PRSDKVTTTYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENASELLTMASHAVPSVGEH
PVLGIGTDIRSLFTAPSASALQKALGFGDVSLLNPILVHCRTSAKPFYAIIHRVTGSIII
DFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMVQEVFELTGYDRVM
AYKFHEDDHGEVVSEVTKPGLEPYLGLHYPATDIPQAARFLFMKNKVRMIVDCNAKHARV
LQDEKLSFDLTLCGSTLRAPHSCHLQYMANMDSIASLVMAVVVNEEDGEGDAPDATTQPQ
KRKRLWGLVVCHNTTPRFVPFPLRYACEFLAQVFAIHVNKEVELDNQMVEKNILRTQTLL
CDMLMRDAPLGIVSQSPNIMDLVKCDGAALLYKDKIWKLGTTPSEFHLQEIASWLCEYHM
DSTGLSTDSLHDAGFPRALSLGDSVCGMAAVRISSKDMIFWFRSHTAGEVRWGGAKHDPD
DRDDARRMHPRSSFKAFLEVVKTRSLPWKDYEMDAIHSLQLILRNAFKDSETTDVNTKVI
YSKLNDLKIDGIQELEAVTSEMVRLIETATVPILAVDSDGLVNGWNTKIAELTGLSVDEA
IGKHFLTLVEDSSVEIVKRMLENALEGTEEQNVQFEIKTHLSRADAGPISLVVNACASRD
LHENVVGVCFVAHDLTGQKTVMDKFTRIEGDYKAIIQNPNPLIPPIFGTDEFGWCTEWNP
AMSKLTGLKREEVIDKMLLGEVFGTQKSCCRLKNQEAFVNLGIVLNNAVTSQDPEKVSFA
FFTRGGKYVECLLCVSKKLDREGVVTGVFCFLQLASHELQQALHVQRLAERTAVKRLKAL
AYIKRQIRNPLSGIMFTRKMIEGTELGPEQRRILQTSALCQKQLSKILDDSDLESIIEGC
LDLEMKEFTLNEVLTASTSQVMMKSNGKSVRITNETGEEVMSDTLYGDSIRLQQVLADFM
LMAVNFTPSGGQLTVSASLRKDQLGRSVHLANLEIRLTHTGAGIPEFLLNQMFGTEEDVS
EEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIITAELAAANK
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgtcaggctctaggccgactcagtcctctgagggctcaaggcgatcaaggcacagcgct
aggatcattgcgcagaccactgtagatgcgaaactccatgctgattttgaggagtcaggc
agctcctttgattactcaacctcagtgcgtgtcactggcccggttgtggagaatcagcca
ccaaggtctgacaaagttaccacgacttatcttcatcatatacagaagggaaagctgatt
cagcccttcggttgtttacttgccttggatgagaagaccttcaaagttattgcatacagc
gagaatgcatctgagctgttgacaatggccagtcatgcagttcctagtgttggcgaacac
cctgttctaggcattgggacagatataaggagtcttttcactgctcctagtgcgtctgca
ttgcagaaagcccttggatttggagatgtctctcttttgaatcccattcttgtgcactgc
aggacttctgcaaagcccttttatgcgattatccacagggttacagggagcatcatcatc
gactttgaacccgtgaagccttatgaagtccccatgacagctgctggtgccttacaatca
tacaagctcgctgccaaagcaatcactaggctgcaatctttacccagcgggagtatggaa
aggctttgtgatacaatggttcaagaggtttttgaactcacggggtatgacagggtgatg
gcttataagtttcatgaagatgatcacggtgaggttgtctccgaggttacaaaacctggg
ctggagccttatcttgggctgcattatcctgccaccgacatccctcaagcagcccgtttt
ctgtttatgaagaacaaggtccggatgatagttgattgcaatgcaaaacatgctagggtg
cttcaagatgaaaagctttcctttgaccttaccttgtgtggctccacccttagagcaccg
cacagctgccatttgcagtacatggccaacatggattcaattgcatctctggttatggcg
gttgtagttaacgaggaagatggagaaggggatgctcctgatgctactacacagcctcaa
aagagaaagagactatggggtttagtggtttgtcacaatacgactccgaggtttgttcca
tttcctctcaggtatgcctgtgagtttctagctcaagtgtttgccatacacgtcaataag
gaggtggaactcgataaccagatggtggagaagaacattttgcgcacgcagacactcttg
tgcgatatgctgatgcgtgatgctccactgggtattgtgtcgcaaagccccaacataatg
gaccttgtgaaatgtgatggagcagctctcttgtataaagacaagatatggaaactggga
acaactccaagtgagttccacctgcaggagatagcttcatggttgtgtgaataccacatg
gattcaacgggtttgagcactgatagtttgcatgacgccgggtttcctagggctctatct
ctcggggattcggtatgtgggatggcagctgtgaggatatcatcgaaagacatgattttc
tggttccgttctcataccgctggtgaagtgagatggggaggtgcgaagcatgatccagat
gatagggatgatgcaaggagaatgcacccaaggtcatcgttcaaggctttccttgaagtg
gtcaagacaaggagtttaccttggaaggactatgagatggatgccatacactccttgcaa
cttattttgaggaatgctttcaaggatagtgaaactactgatgtgaatacaaaggtcatt
tactcgaagctaaatgatctcaaaattgatggtatacaagaactagaagctgtgaccagt
gagatggttcgtttaattgagactgctacggtgccaatattggcggttgattctgatgga
ctggttaatggttggaacacgaaaattgctgagctgactggtctttcggttgatgaagca
atcgggaagcatttcctcacacttgttgaagattcttcagtggaaatcgttaaaaggatg
ctagagaacgcattagaaggaactgaggagcagaatgtccagtttgagatcaagacacat
ctgtccagggctgatgctgggccaataagtttagttgtaaatgcatgcgcaagtagagat
ctccatgaaaacgtggttggggtgtgttttgtagcccatgatcttactggccagaagact
gtgatggacaagtttacgcggattgaaggtgattacaaggcaatcatccaaaatccaaac
ccgctgatcccgccaatatttggtaccgatgagtttggatggtgcacagagtggaatcca
gcaatgtcaaagttaaccggtttgaagcgagaggaagtgattgacaaaatgctcttagga
gaagtatttgggacgcagaagtcatgttgtcgtctaaagaatcaagaagcctttgtaaac
cttgggattgtgctgaacaatgctgtgaccagtcaagatccagagaaagtatcgtttgct
ttctttacaagaggtggcaagtatgtggagtgtctgttgtgtgtgagtaagaaactggac
agggaaggtgtagtgacaggtgtcttctgtttcctgcaacttgccagccatgagctgcag
caagcgctccatgttcaacgtttagctgagcgaaccgcagtgaagagactaaaggctcta
gcatacataaaaagacagatcaggaatccgctatctgggatcatgtttacaaggaaaatg
atagagggtactgaattaggaccagagcaaagacggattttgcaaactagcgcgttatgt
cagaagcaactaagcaagatcctcgatgattcggatcttgaaagcatcattgaaggatgc
ttggatttggaaatgaaagaattcaccttaaatgaagtgttgactgcttccacaagtcaa
gtaatgatgaagagtaacggaaagagtgttcggataacaaatgagaccggagaagaagta
atgtctgacactttgtatggagacagtattaggcttcaacaagtcttggcagatttcatg
ctgatggctgtaaactttacaccatccggaggtcagctaactgtttcagcttccctgagg
aaggatcagctcgggcgttctgtgcatcttgctaatctagagatcaggttaacgcatacc
ggagctgggatacctgagtttttactaaaccaaatgtttgggactgaggaagatgtgtca
gaagaaggattgagcttaatggttagccggaaactggtgaagctgatgaatggagatgtt
cagtacttgagacaagctgggaaatcaagtttcattatcactgcggaactcgctgcagca
aacaagtag

DBGET integrated database retrieval system