Arabidopsis thaliana (thale cress): AT1G20140 Help Entry AT1G20140         CDS       T00041                                  Symbol SK4 Name (RefSeq) SKP1-like 4   KO K03094   S-phase kinase-associated protein 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath03083   Polycomb repressive complex ath04120   Ubiquitin mediated proteolysis ath04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AT1G20140 (SK4)    04120 Ubiquitin mediated proteolysis     AT1G20140 (SK4)   09126 Chromosome    03083 Polycomb repressive complex     AT1G20140 (SK4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT1G20140 (SK4)    04121 Ubiquitin system [BR:ath04121]     AT1G20140 (SK4)    03036 Chromosome and associated proteins [BR:ath03036]     AT1G20140 (SK4) Membrane trafficking [BR:ath04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     AT1G20140 (SK4) Ubiquitin system [BR:ath04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      AT1G20140 (SK4)    Cul7 complex      AT1G20140 (SK4) Chromosome and associated proteins [BR:ath03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      AT1G20140 (SK4)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      AT1G20140 (SK4) SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  838604 NCBI-ProteinID:  NP_564105 TAIR:  AT1G20140 UniProt:  Q9LNT9 LinkDB All DBs Position 1:6986312..6987863 Genome browser AA seq 163 aa AA seqDB search MAETKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEY CKKHVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLT CKAVADQMRGKTPEQMRAHFNIKNDYTPEEEAEVRNENKWAFE NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atggcagaaacgaagaagatgatcatccttaagagctccgacggtgaatccttcgagatc gaggaagccgtcgctgttaagtcccagacgattaagcacatgattgaggacgactgtgcc gataacggaattccacttcccaatgtcaccggagccatcctcgccaaggttattgagtat tgcaagaagcacgttgaagccgctgctgaagctggtggagacaaggatttctatggttcc gctgagaacgacgagcttaagaattgggacagcgaattcgtcaaagtcgatcagcctact ctcttcgatctcatcttggctgcgaactatttgaacatcggtggacttcttgaccttacg tgcaaggccgtggctgatcagatgagaggcaaaactccagagcagatgcgtgcacacttc aacatcaagaacgattacacacctgaggaagaggcggaggttcgcaatgagaacaagtgg gcgttcgagtga

DBGET integrated database retrieval system