KEGG   Arabidopsis thaliana (thale cress): AT1G50030
Entry
AT1G50030         CDS       T00041                                 
Symbol
TOR
Name
(RefSeq) target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT1G50030 (TOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT1G50030 (TOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT1G50030 (TOR)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT1G50030 (TOR)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   AT1G50030 (TOR)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    AT1G50030 (TOR)
   mTORC2 complex
    AT1G50030 (TOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC Cnd1 HEAT_EZ HEAT_2 HEAT DRIM
Other DBs
NCBI-GeneID: 841427
NCBI-ProteinID: NP_175425
TAIR: AT1G50030
UniProt: Q9FR53 A0A178WN52
LinkDB
Position
1:complement(18522248..18539995)
AA seq 2481 aa
MSTSSQSFVAGRPASMASPSQSHRFCGPSATASGGGSFDTLNRVIADLCSRGNPKEGAPL
AFRKHVEEAVRDLSGEASSRFMEQLYDRIANLIESTDVAENMGALRAIDELTEIGFGENA
TKVSRFAGYMRTVFELKRDPEILVLASRVLGHLARAGGAMTSDEVEFQMKTAFDWLRVDR
VEYRRFAAVLILKEMAENASTVFNVHVPEFVDAIWVALRDPQLQVRERAVEALRACLRVI
EKRETRWRVQWYYRMFEATQDGLGRNAPVHSIHGSLLAVGELLRNTGEFMMSRYREVAEI
VLRYLEHRDRLVRLSITSLLPRIAHFLRDRFVTNYLTICMNHILTVLRIPAERASGFIAL
GEMAGALDGELIHYLPTIMSHLRDAIAPRKGRPLLEAVACVGNIAKAMGSTVETHVRDLL
DVMFSSSLSSTLVDALDQITISIPSLLPTVQDRLLDCISLVLSKSHYSQAKPPVTIVRGS
TVGMAPQSSDPSCSAQVQLALQTLARFNFKGHDLLEFARESVVVYLDDEDAATRKDAALC
CCRLIANSLSGITQFGSSRSTRAGGRRRRLVEEIVEKLLRTAVADADVTVRKSIFVALFG
NQCFDDYLAQADSLTAIFASLNDEDLDVREYAISVAGRLSEKNPAYVLPALRRHLIQLLT
YLELSADNKCREESAKLLGCLVRNCERLILPYVAPVQKALVARLSEGTGVNANNNIVTGV
LVTVGDLARVGGLAMRQYIPELMPLIVEALMDGAAVAKREVAVSTLGQVVQSTGYVVTPY
KEYPLLLGLLLKLLKGDLVWSTRREVLKVLGIMGALDPHVHKRNQQSLSGSHGEVPRGTG
DSGQPIPSIDELPVELRPSFATSEDYYSTVAINSLMRILRDASLLSYHKRVVRSLMIIFK
SMGLGCVPYLPKVLPELFHTVRTSDENLKDFITWGLGTLVSIVRQHIRKYLPELLSLVSE
LWSSFTLPGPIRPSRGLPVLHLLEHLCLALNDEFRTYLPVILPCFIQVLGDAERFNDYTY
VPDILHTLEVFGGTLDEHMHLLLPALIRLFKVDAPVAIRRDAIKTLTRVIPCVQVTGHIS
ALVHHLKLVLDGKNDELRKDAVDALCCLAHALGEDFTIFIESIHKLLLKHRLRHKEFEEI
HARWRRREPLIVATTATQQLSRRLPVEVIRDPVIENEIDPFEEGTDRNHQVNDGRLRTAG
EASQRSTKEDWEEWMRHFSIELLKESPSPALRTCAKLAQLQPFVGRELFAAGFVSCWAQL
NESSQKQLVRSLEMAFSSPNIPPEILATLLNLAEFMEHDEKPLPIDIRLLGALAEKCRVF
AKALHYKEMEFEGPRSKRMDANPVAVVEALIHINNQLHQHEAAVGILTYAQQHLDVQLKE
SWYEKLQRWDDALKAYTLKASQTTNPHLVLEATLGQMRCLAALARWEELNNLCKEYWSPA
EPSARLEMAPMAAQAAWNMGEWDQMAEYVSRLDDGDETKLRGLASPVSSGDGSSNGTFFR
AVLLVRRAKYDEAREYVERARKCLATELAALVLESYERAYSNMVRVQQLSELEEVIEYYT
LPVGNTIAEERRALIRNMWTQRIQGSKRNVEVWQALLAVRALVLPPTEDVETWLKFASLC
RKSGRISQAKSTLLKLLPFDPEVSPENMQYHGPPQVMLGYLKYQWSLGEERKRKEAFTKL
QILTRELSSVPHSQSDILASMVSSKGANVPLLARVNLKLGTWQWALSSGLNDGSIQEIRD
AFDKSTCYAPKWAKAWHTWALFNTAVMSHYISRGQIASQYVVSAVTGYFYSIACAANAKG
VDDSLQDILRLLTLWFNHGATADVQTALKTGFSHVNINTWLVVLPQIIARIHSNNRAVRE
LIQSLLIRIGENHPQALMYPLLVACKSISNLRRAAAQEVVDKVRQHSGALVDQAQLVSHE
LIRVAILWHEMWHEALEEASRLYFGEHNIEGMLKVLEPLHDMLDEGVKKDSTTIQERAFI
EAYRHELKEAHECCCNYKITGKDAELTQAWDLYYHVFKRIDKQLASLTTLDLESVSPELL
LCRDLELAVPGTYRADAPVVTISSFSRQLVVITSKQRPRKLTIHGNDGEDYAFLLKGHED
LRQDERVMQLFGLVNTLLENSRKTAEKDLSIQRYSVIPLSPNSGLIGWVPNCDTLHHLIR
EHRDARKIILNQENKHMLSFAPDYDNLPLIAKVEVFEYALENTEGNDLSRVLWLKSRSSE
VWLERRTNYTRSLAVMSMVGYILGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKF
PEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRTNKDSVMAMMEAFVHDPLINWRL
FNFNEVPQLALLGNNNPNAPADVEPDEEDEDPADIDLPQPQRSTREKEILQAVNMLGDAN
EVLNERAVVVMARMSHKLTGRDFSSSAIPSNPIADHNNLLGGDSHEVEHGLSVKVQVQKL
INQATSHENLCQNYVGWCPFW
NT seq 7446 nt   +upstreamnt  +downstreamnt
atgtctacctcgtcgcaatcttttgtggctggacggcctgcatccatggcttccccttcg
caatcgcaccgcttttgtggtccctcagccaccgcttctggtggcggaagctttgacact
ttgaatcgtgtcatcgctgacctttgcagccgtggtaatcctaaggagggagctccttta
gcgtttaggaaacacgtagaggaagcagttcgtgatcttagtggtgaagcttcctctagg
ttcatggagcaattatatgacaggattgctaatttaattgagagcactgatgtggcggaa
aacatgggtgcactcagagccattgatgagttgacggagattggatttggtgagaatgct
actaaggtttctagatttgcgggttacatgaggactgtgttcgagttgaagcgtgatcct
gaaatcttggtgcttgctagtagagttttggggcaccttgctcgggcaggtggagcaatg
acttctgatgaagtggagtttcagatgaaaacagcttttgattggcttcgcgtagacagg
gtggaatatcgtcgtttcgccgccgttttaatattaaaggagatggccgaaaatgcttct
actgtctttaacgttcatgtccctgaatttgtggatgctatctgggttgcacttagggac
ccccagttgcaagtgcgagaacgagctgttgaagctttgcgtgcatgccttcgtgttatt
gagaaaagggagactcgatggcgagtgcagtggtactatcgaatgtttgaagctacacag
gatgggttgggcagaaatgctccggttcacagtattcatggttctttacttgccgtgggg
gagctgttgaggaatacaggtgagttcatgatgtctaggtatagagaagttgccgaaatt
gtcctcagataccttgaacatcgtgatcgccttgttcgccttagcatcacctcgttactg
cctcgcattgctcactttctccgtgaccggtttgtgacaaactatttaacgatatgcatg
aatcatattcttactgtgttaagaataccggctgaaagagccagtgggttcatcgccctt
ggggaaatggctggtgctttggatggtgagcttatccattatttgccgacaattatgtct
catctgcgggatgcgattgctccacgtaaaggcagacctttgcttgaagctgtggcttgt
gttggtaacatcgcaaaggcaatgggatccacagtggaaactcatgttcgagatctttta
gatgttatgttttcatctagtctctcttccacacttgttgacgctcttgaccagataacc
atcagcattccttctttgctgccaacagtacaagatcggcttctagattgcatttcgttg
gttctttcaaaatcccattattctcaagcaaagcctcctgttaccattgtccgaggtagt
acagtgggcatggcaccacagtcttctgaccctagttgttcagctcaagttcaactagcc
ctgcagactcttgctcgtttcaatttcaagggacatgatcttcttgaatttgctcgggag
tcagttgttgtttatttggatgatgaggatgcagccacaagaaaagatgctgctttgtgt
tgttgcagactaattgcaaattctctttctggcatcacacaatttggctcgagcaggtca
acacgagcaggggggagacgcaggcgccttgtggaagagattgtggaaaagcttctcagg
acagccgttgcagatgctgatgtaactgttcgcaaatctatattcgttgctttatttggc
aaccaatgtttcgatgattatctagcacaggctgatagtttgactgccatttttgcttcc
ttaaatgatgaggaccttgatgttcgagaatatgccatctcagttgctggaaggttatcg
gaaaaaaatccagcatacgtacttccagcacttcgtcgccatcttatacagttgttgacc
tatcttgagctgagtgcagataacaagtgcagggaagagagtgcaaagctccttggttgt
ttagttcgaaattgtgaacggctcattcttccatacgtagcccctgtccaaaaggcactt
gttgcgagacttagtgaaggaactggagtgaatgctaacaataatattgtcactggagtt
ctcgtaactgttggggatcttgcaagagtgggtggcttggcaatgagacaatatattccg
gagctgatgcctttaattgttgaagctttaatggatggagctgctgtagcaaaacgtgag
gtggctgtttctactcttggtcaagttgttcaaagtacagggtatgttgtgactccatac
aaggaatacccattgttgcttgggttactcttgaaattgctgaagggtgacttagtgtgg
tctaccagacgagaagtgctcaaggttcttggaattatgggcgctttggatcctcatgtg
cataaacgtaaccaacaaagtttatcaggatcacatggtgaagttcctcgcggcactggt
gattctggtcaacctattccatcaattgatgagttacctgtcgaactccggccgtcattt
gctacatctgaggattattactcaacggttgctatcaactcgcttatgcgaattcttaga
gatgcatcacttcttagttaccacaaaagggttgttagatctctgatgatcattttcaag
tcaatgggattgggatgcgtgccttacttgccgaaggttttacctgagctttttcacact
gttcgaacatctgatgagaacctgaaggacttcattacgtggggtcttgggactcttgtt
tccattgttcgccagcacatacgcaagtatctgccagagctgctttcattagtctctgaa
ctatggtcatccttcaccttgcccggtcccatacgcccatcacgtggtcttccggttctg
catctactggaacatctttgcttggcacttaatgatgaattcagaacttatcttccagtc
atccttccatgtttcatccaagtattaggtgacgccgagcggtttaatgattacacctat
gttcctgatattctccacacactcgaagtgtttggcggaactcttgatgagcacatgcat
ttactccttccggcacttattcgattgtttaaagtagatgctcctgtagctataagacgc
gatgccatcaaaactttgacaagagtaatcccgtgtgttcaggttactggtcatatctcc
gctctcgtgcatcacttgaagctagtattagatgggaagaatgatgagttgcggaaagat
gctgtcgatgcactatgctgtttggctcatgcacttggagaggacttcaccatattcatt
gaatcaattcacaagcttttattgaagcatcgattgcggcataaagaatttgaggaaatt
catgctcgctggcggagacgtgaaccattgattgtagctacaactgcaacccaacaatta
agtaggcgactgccagttgaggttatcagggatcctgtaattgagaatgagatcgatcct
ttcgaagaaggaactgacagaaaccatcaggttaatgatggtagactacggacagctgga
gaagcttctcaacgcagcaccaaagaagattgggaggaatggatgagacattttagtatt
gaattacttaaggagtctccctctccagcattaagaacttgtgcaaaacttgctcagttg
cagccatttgtcgggagagagttgtttgctgctggctttgtcagttgctgggcacagcta
aacgagtctagccaaaagcagttagttaggagcttggaaatggccttttcatctccaaat
atccctccagaaattttagctacactactcaatttggcagagtttatggaacatgatgag
aagcctcttcccattgatattcgtcttctgggggctcttgctgaaaagtgccgtgttttt
gccaaagctctgcattataaagagatggaatttgaaggtccacgatccaagaggatggat
gccaacccagttgctgttgtcgaggctcttatacacataaataatcagttacaccagcat
gaggctgctgtcggtatactaacctatgctcaacaacatcttgatgtgcaattaaaagaa
tcatggtatgagaagctgcagcgctgggacgatgcactcaaggcgtacactttgaaagca
tctcaaacaacaaatcctcatcttgtattagaagccacattaggacaaatgagatgtctt
gctgcacttgcacgatgggaagagctcaacaatctctgcaaagagtactggagtcctgct
gagccatctgcgcgtctggaaatggcaccaatggctgcacaagctgcatggaacatggga
gagtgggatcaaatggccgaatatgtgtctcggctagatgatggtgatgaaacaaagctt
cggggtttagcaagcccggtttctagtggcgatgggagcagtaatggcacattcttcagg
gctgttctgttagttcgaagggcaaagtacgacgaggcacgcgaatatgtggaaagagct
agaaaatgtcttgccacagaacttgcagcgctggttttggagagctatgagcgtgcgtac
agcaatatggttcgtgttcagcagctgtcagaactagaggaggtaattgaatattatacg
ctgcctgtgggaaatactattgccgaagaacggagagctctaattcgtaatatgtggact
cagcggattcagggatctaagcgtaatgtggaggtgtggcaagcacttttggctgtccgg
gcacttgtgctacctcctacagaagatgtggaaacttggctcaagtttgcctcgctttgt
cgaaagagtgggaggatcagtcaggcgaaatctactctactcaagctcttaccgtttgat
ccagaagtatcaccagaaaacatgcaatatcacggacctccacaagtgatgcttggatac
ttaaaataccaatggtcacttggagaggaacgtaagcgcaaagaggcatttaccaagctg
cagattctaacgagagagctctcaagtgtgccacattctcaatctgacatactggctagc
atggtatctagcaagggcgcaaatgttccacttcttgcacgtgtaaatctcaaactggga
acgtggcagtgggcactttcttccggtttgaatgatgggtctattcaagaaattcgtgat
gcgtttgacaaatctacttgctatgctcctaaatgggctaaagcatggcacacatgggca
ttattcaatacagcagtgatgtcgcattacatttcaagaggtcaaattgcttcccagtac
gttgtttctgcagtcactggatatttttattctatagcatgtgcagcaaatgccaaagga
gttgatgatagtttacaggacatactgcgtcttctgacattgtggttcaaccatggagct
acagctgatgtccaaaccgcattgaagacaggattcagtcatgtcaacattaacacatgg
cttgttgtgctacctcaaatcattgctaggatacattctaataatcgtgctgtcagggaa
ctgattcagtctcttctcatccgcataggcgaaaaccacccacaggctctgatgtatccc
cttctcgttgcatgtaaatcaataagcaatcttcggagagctgcggctcaagaggtggtt
gataaagttcgccagcacagtggtgcactcgtggatcaggcgcaacttgtatcacatgaa
cttatcagggttgccatactttggcatgaaatgtggcatgaagcactagaagaagctagt
cgcttgtattttggtgaacataacattgaaggcatgctgaaagtacttgaacccttacat
gacatgctcgacgaaggtgtaaaaaaggacagtacgaccatacaggaaagagcatttata
gaggcataccgtcacgaactaaaagaggcacatgaatgctgttgcaattacaagataact
gggaaagatgctgaacttacacaggcttgggatctttactatcacgttttcaaacggatt
gacaaacagctagccagtctcacgacattggatttggaatctgtttctcctgagttgctg
ctgtgccgtgacttggagctagcagttcctggaacatatcgtgcagatgcccccgtcgtg
actatatcatctttttcacgccaacttgttgttataacctctaaacaaagaccaaggaaa
ttgactattcacggaaatgacggtgaggactacgccttcttgttgaagggacatgaagat
ttaaggcaagatgagcgtgttatgcagctttttggtttggtgaacactttgcttgagaat
tccagaaaaacagccgaaaaagatctttccattcaacgctattctgtaataccactatct
cccaatagtggactcatcggatgggttccgaactgcgatacccttcaccatcttattcga
gagcacagagatgcaagaaagatcattcttaatcaagaaaataagcatatgttgagtttt
gctccagactatgacaatctaccgcttatagcaaaggttgaagtatttgagtatgctcta
gaaaacacagagggaaatgatctatccagggttctctggttaaaaagtcgctcgtcagaa
gtttggctagaaagaagaacaaactatactagaagtttagcagttatgagtatggttggt
tatattcttgggttaggtgatcgacacccaagtaaccttatgcttcatagatacagtgga
aagatcttgcatattgattttggagattgttttgaggcttctatgaatagagagaagttt
cctgaaaaggttccattccgcctgacaagaatgcttgtcaaagcaatggaagtcagtggc
attgaaggaaacttccgctcaacctgcgaaaacgttatgcaagttctcagaaccaataaa
gatagtgtaatggcaatgatggaagcgtttgtacatgatcctttaatcaattggcgtctt
ttcaatttcaatgaagtcccccaattagcactgctcggtaacaacaaccccaatgctcct
gctgatgttgagcctgacgaagaagatgaagatcccgctgatatagatcttcctcagcct
caaaggagtactcgagagaaggagattcttcaggctgtaaatatgcttggagatgctaat
gaagttttaaatgagcgtgccgtagttgttatggcacgtatgagtcataagcttacaggg
cgtgatttttcttcgtctgcaattccgagcaatcccattgctgatcataataacttgctc
ggaggagattctcatgaagtcgaacatggtttgtctgtgaaagttcaggttcaaaaacta
atcaatcaagccacttcccatgagaatctctgtcaaaactatgttgggtggtgccctttc
tggtga

DBGET integrated database retrieval system