KEGG   Arabidopsis thaliana (thale cress): AT1G56650
Entry
AT1G56650         CDS       T00041                                 
Symbol
PAP1
Name
(RefSeq) production of anthocyanin pigment 1
  KO
K16166  transcription factor MYB75
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G56650 (PAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT1G56650 (PAP1)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    AT1G56650 (PAP1)
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 842120
NCBI-ProteinID: NP_176057
TAIR: AT1G56650
UniProt: Q9FE25 A0A654EJ34
LinkDB
Position
1:complement(21233555..21235292)
AA seq 248 aa
MEGSSKGLRKGAWTTEEDSLLRQCINKYGEGKWHQVPVRAGLNRCRKSCRLRWLNYLKPS
IKRGKLSSDEVDLLLRLHRLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEPCCKIKM
KKRDITPIPTTPALKNNVYKPRPRSFTVNNDCNHLNAPPKVDVNPPCLGLNINNVCDNSI
IYNKDKKKDQLVNNLIDGDNMWLEKFLEESQEVDILVPEATTTEKGDTLAFDVDQLWSLF
DGETVKFD
NT seq 747 nt   +upstreamnt  +downstreamnt
atggagggttcgtccaaagggctgcgaaaaggtgcttggactactgaagaagatagtctc
ttgagacagtgcattaataagtatggagaaggcaaatggcaccaagttcctgtaagagct
gggctaaaccggtgcaggaaaagttgtagattaagatggttgaactatttgaagccaagt
atcaagagaggaaaacttagctctgatgaagtcgatcttcttcttcgccttcataggctt
ctagggaataggtggtctttaattgctggaagattacctggtcggaccgcaaatgacgtc
aagaattactggaacactcatctgagtaagaaacatgaaccgtgttgtaagataaagatg
aaaaagagagacattacgcccattcctacaacaccggcactaaaaaacaatgtttataag
cctcgacctcgatccttcacagttaacaacgactgcaaccatctcaatgccccaccaaaa
gttgacgttaatcctccatgccttggacttaacatcaataatgtttgtgacaatagtatc
atatacaacaaagataagaagaaagaccaactagtgaataatttgattgatggagataat
atgtggttagagaaattcctagaggaaagccaagaggtagatattttggttcctgaagcg
acgacaacagaaaagggggacaccttggcttttgacgttgatcaactttggagtcttttc
gatggagagactgtgaaatttgattag

DBGET integrated database retrieval system