KEGG   Arabidopsis thaliana (thale cress): AT1G60490
Entry
AT1G60490         CDS       T00041                                 
Symbol
VPS34
Name
(RefSeq) vacuolar protein sorting 34
  KO
K00914  phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00562  Inositol phosphate metabolism
ath01100  Metabolic pathways
ath04070  Phosphatidylinositol signaling system
ath04136  Autophagy - other
ath04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AT1G60490 (VPS34)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AT1G60490 (VPS34)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AT1G60490 (VPS34)
   04136 Autophagy - other
    AT1G60490 (VPS34)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT1G60490 (VPS34)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     AT1G60490 (VPS34)
Membrane trafficking [BR:ath04131]
 Endocytosis
  Macropinocytosis
   Kinases
    AT1G60490 (VPS34)
  Rab GTPases and associated proteins
   Rab associated proteins
    AT1G60490 (VPS34)
 Endosome - Lysosome transport
    AT1G60490 (VPS34)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    AT1G60490 (VPS34)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 DUF72
Other DBs
NCBI-GeneID: 842344
NCBI-ProteinID: NP_176251
TAIR: AT1G60490
UniProt: P42339 A0A654EJR0
LinkDB
Position
1:complement(22285572..22290389)
AA seq 814 aa
MGANEFRFFLSCDINSPVTFRIEKLDGNLPVKKSSDSGVVSIAEEKKPELYIECALYIDG
APFGLPMRTRLKTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKTEGLIGGATV
LLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHERGELERLEKLMNKYERGQIQ
SIDWLDRLMLKSLDTIKEQESTKHGSSHLFVVIDFCSFEHRVVFQESGANLFITAPIGST
NEFVTVWDTELGKTNPSENKQLKLARSLDRGIIDRDLKPSNIERKSIQRVLKYPPTRTLS
GDERQLLWKFRFSLMSEKRALTKFLRCVEWSDVQEAKQAIQLMYKWEMIDVCDALELLSP
LFESEEVRAYAVSVLERADDEELQCYLLQLVQALRFERSDRSCLSQFLVQRALQNIELAS
FLRWYVAVELHDHVYAKRFYSTYELLEENIIKLPPGVNGEDGYQLWQSLVRQTELTAQLC
SITREVRNVRGNTQKKIEKLRQLLGGLLSELTYFEEPIRSPLTPNVLIKGIVAGESSLFK
SALHPLRLTFRTPEEGGSCKLIFKKGDDLRQDQLVVQMVWLMDRLLKLENLDLCLTPYKV
LATGHDEGMLEFIPSRSLAQILSEHRSITSYLQKFHPDEHAPFGITATCLDTFIKSCAGY
SVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCKEMVEAMGGAES
QYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILKLQEKFRLDMDD
EACIHFFQDLINESVSALFPQMVETIHRWAQYWR
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgggtgcgaacgagtttcgtttcttcctctcctgcgatatcaattcgccggtcactttt
cgtatcgagaagcttgatggaaacctccccgtcaagaaatcgtctgattcgggagttgtc
tccatcgcagaggagaaaaaaccagagctttacattgagtgtgcattgtacattgatgga
gctccttttggccttcccatgagaacaagattgaaaactacaggaccaccatactgctgg
aacgaactcatcactctcagttctaaataccgggacttgactgcccattcacaacttgcg
attacagtatgggatgtttcgtgtggcaaaactgagggactgattggtggggcaacagtc
cttctttttaacagcaagatgcaaatgaaatcagggaagcagaagctaaggctctggcag
gggaaagaagcggatggttcatttccaacctctactcctggaaaggttccacggcatgag
cgtggagagctagagcgtttagagaagctcatgaataagtatgagagggggcagattcaa
agcatagattggctggatcgacttatgttgaaatccttggatacgattaaggagcaagaa
agcaccaaacatggaagctcacatctgtttgtggtcattgatttctgtagttttgaacat
cgggttgtatttcaggagtctggagccaatttgttcataactgccccaataggttcaaca
aatgaatttgttactgtctgggatacagaactgggaaagactaatccttcagagaacaag
caactaaagctggcaaggagcttggatcgtggcattatcgacagggatctaaagccaagt
aatatcgagcggaaatccattcaaagagttttgaaatatccgccaacaaggacattgagt
ggagatgaaagacaacttctttggaagtttcgtttctctctaatgtctgaaaagagagct
ctaacaaagtttcttcgttgtgtggagtggagtgatgttcaggaagcaaagcaagcaatt
caactgatgtacaaatgggaaatgatagatgtatgtgatgctttggagctattgtctcct
ctatttgagagtgaagaggttcgagcttatgctgtgagtgtcctggaaagagctgatgat
gaagagcttcagtgttacttgcttcaactggttcaggctcttcgttttgaacgctctgat
agatcttgcctttctcaattccttgtccagagggcattacagaatattgagttggccagt
tttcttcggtggtatgttgctgtggaacttcatgaccatgtctatgccaagagattttac
agtacatatgagttactcgaggagaatataatcaagctgccgcctggtgttaacggcgaa
gatggatatcaattgtggcaaagtttggtgcgccaaacagaactgactgctcagttatgt
tccattacacgagaagtgaggaatgtacgtggaaacacccagaaaaaaattgagaagctc
aggcagcttttaggtggactgcttagcgaacttacctacttcgaagagcctattcgatca
ccgcttacccctaatgttctcataaaggggattgtggcaggagaatcatcactctttaaa
agtgcattgcatcctctgcgccttactttccgaacaccagaagaaggaggaagttgcaaa
cttatatttaagaagggagatgatctccggcaagaccaactggttgttcaaatggtttgg
ctcatggatagactacttaagctggaaaatcttgatctatgcctaacgccttataaggtg
ttagcaactggacatgacgaagggatgttggaattcataccgtcccgttctttggctcag
attctctcagagcaccgaagcataacaagttatctgcagaagtttcatcctgatgagcat
gcacctttcgggataacagccacttgtcttgatacatttataaaaagttgtgcgggctat
tctgtgatcacatatatacttggcattggagacagacacctggacaacctcctccttaca
gatgatggtcgtctgttccacgttgattttgcttttattctcggtagagatcctaaacca
ttccctccacctatgaaactctgcaaagaaatggtggaagccatgggcggagcagaaagc
caatactacacaaggttcaaatcctactgttgcgaagcctacaacattctccggaaatcg
agcaaccttattttgaatctgtttcatctcatggcgggttcaactattcccgatatagct
tcagacccagaaaagggcattctcaaactccaagaaaagtttaggcttgacatggatgat
gaagcatgcatccatttctttcaagacctgattaatgaaagcgtaagtgcgctgttcccg
caaatggttgaaaccatacacagatgggctcaatactggcgttga

DBGET integrated database retrieval system