Arabidopsis thaliana (thale cress): AT1G64750 Help Entry AT1G64750         CDS       T00041                                  Symbol DSS1(I) Name (RefSeq) deletion of SUV3 suppressor 1(I)   KO K10881   26 proteasome complex subunit DSS1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath03050   Proteasome ath03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     AT1G64750 (DSS1(I))   09124 Replication and repair    03440 Homologous recombination     AT1G64750 (DSS1(I))  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ath03019]     AT1G64750 (DSS1(I))    04131 Membrane trafficking [BR:ath04131]     AT1G64750 (DSS1(I))    03051 Proteasome [BR:ath03051]     AT1G64750 (DSS1(I))    03400 DNA repair and recombination proteins [BR:ath03400]     AT1G64750 (DSS1(I)) Messenger RNA biogenesis [BR:ath03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      AT1G64750 (DSS1(I)) Membrane trafficking [BR:ath04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     AT1G64750 (DSS1(I)) Proteasome [BR:ath03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      AT1G64750 (DSS1(I)) DNA repair and recombination proteins [BR:ath03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      AT1G64750 (DSS1(I)) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DSS1_SEM1 DUF2947 Motif Other DBs NCBI-GeneID:  842783 NCBI-ProteinID:  NP_564839 TAIR:  AT1G64750 UniProt:  Q9XIR8 A0A384KR55 Q2PDG5 LinkDB All DBs Position 1:complement(24052362..24053923) Genome browser AA seq 74 aa AA seqDB search MAAEPKAATAEVVKMDLFEDDDEFEEFEINEDWLEKEEVKEVSQQWEDDWDDDDVNDDFS RQLRKELENGTDKK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcggcagaaccgaaggcagcgactgctgaagtagtaaagatggatctgtttgaggac gacgatgagttcgaggaatttgaaattaacgaagattggttggagaaagaagaagtgaag gaagttagccagcagtgggaagatgactgggatgatgatgatgtcaatgacgacttctca cgtcagttaaggaaggagcttgagaatggtactgacaagaaataa

DBGET integrated database retrieval system