KEGG   Arabidopsis thaliana (thale cress): AT1G68050
Entry
AT1G68050         CDS       T00041                                 

Symbol
FKF1
Name
(RefSeq) flavin-binding, kelch repeat, f box 1
  KO
K12116  flavin-binding kelch repeat F-box protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G68050 (FKF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT1G68050 (FKF1)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     AT1G68050 (FKF1)
SSDB
Motif
Pfam: Kelch_4 Kelch_3 Kelch_2 Kelch_5 Kelch_1 PAS_9 Kelch_6 PAS PAS_3 F-box PAS_4 F-box-like
Other DBs
NCBI-GeneID: 843133
NCBI-ProteinID: NP_564919
TAIR: AT1G68050
UniProt: Q9C9W9 A0A178W8F6
LinkDB
Position
1:25508639..25510907
AA seq 619 aa
MAREHAIGEATGKRKKRGRVEEAEEYCNDGIEEQVEDEKLPLEVGMFYYPMTPPSFIVSD
ALEPDFPLIYVNRVFEVFTGYRADEVLGRNCRFLQYRDPRAQRRHPLVDPVVVSEIRRCL
EEGIEFQGELLNFRKDGTPLVNRLRLAPIRDDDGTITHVIGIQVFSETTIDLDRVSYPVF
KHKQQLDQTSECLFPSGSPRFKEHHEDFCGILQLSDEVLAHNILSRLTPRDVASIGSACR
RLRQLTKNESVRKMVCQNAWGKEITGTLEIMTKKLRWGRLARELTTLEAVCWRKFTVGGI
VQPSRCNFSACAVGNRLVLFGGEGVNMQPLDDTFVLNLDAECPEWQRVRVTSSPPGRWGH
TLSCLNGSWLVVFGGCGRQGLLNDVFVLDLDAKHPTWKEVAGGTPPLPRSWHSSCTIEGS
KLVVSGGCTDAGVLLSDTFLLDLTTDKPTWKEIPTSWAPPSRLGHSLSVFGRTKILMFGG
LANSGHLKLRSGEAYTIDLEDEEPRWRELECSAFPGVVVPPPRLDHVAVSMPCGRVIIFG
GSIAGLHSPSQLFLIDPAEEKPSWRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHTGEE
WILNELHELCLASRQDSDL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggcgagagaacatgcgatcggagaagccaccggaaaacgaaagaaacgcggcagagtt
gaagaagcagaagaatactgtaacgatggaatcgaagaacaagtagaggatgagaagctt
ccgttagaggttgggatgttctattacccaatgactccgccttcgttcattgtttccgat
gctctggagccagattttcctttgatctatgtcaacagagtcttcgaagtcttcactggc
tatcgtgccgatgaagttcttggtcgtaactgtcgattcctacagtacagagatcctcga
gctcaaaggcgtcacccattggttgatcctgtggttgtatctgagattaggagatgtctt
gaagaaggtattgaattccaaggagagcttcttaatttcagaaaagatggtactcctttg
gttaacagactacggcttgctccaatacgtgacgatgatggaaccattacacacgtaatt
gggatacaggtcttctctgaaacgactatagaccttgaccgtgtctcgtatcctgtgttc
aaacataaacaacagcttgatcaaacatctgagtgcttgtttccaagtggaagcccgagg
tttaaggagcatcatgaagatttctgtgggatattgcagctatctgatgaagttttggct
cataacatcttatctcggttaactccaagggacgttgcttcaattggttctgcttgcagg
aggttgaggcagttgacgaagaacgagagtgtgaggaagatggtatgtcagaatgcgtgg
ggaaaagagataactggaacactggagattatgactaagaagctaagatggggtcggtta
gctagagagctcaccactcttgaagctgtgtgttggcgtaaatttactgttggagggatt
gtacaaccttcccgctgcaatttcagcgcgtgtgctgttgggaaccggcttgtgctattt
ggtggggaaggggttaacatgcagccattggatgatacttttgttctcaatcttgatgca
gagtgtcctgagtggcagcgtgtgagggtgacgtcgtcgcctccaggacgttggggacac
acactctcgtgtctcaacgggtcgtggttggtagtctttggagggtgtggaagacaagga
ttgcttaatgatgtatttgtgcttgatctagacgctaagcatcccacatggaaggaagta
gcaggaggaactcctccattgccaagatcttggcacagctcgtgcaccattgagggctct
aaactggttgtctcaggtggctgcacagacgctggagtgcttctcagcgacaccttcttg
ttggatctgacaacagataaaccgacatggaaagagatcccgacatcatgggctcctcct
tctagacttgggcattctttatcggtctttggtcggactaaaatcctaatgtttggcggg
cttgcaaatagtggtcatctaaagctaaggtcaggggaggcatacactatagacttggag
gatgaagaaccaagatggagagagcttgagtgtagcgcattcccaggcgtggttgtaccg
cctccaagactagaccatgtggctgtgagcatgccgtgtggtagggtcatcatctttgga
gggtcgattgcagggcttcactctccttcgcaactgtttctaatagatcctgcagaagag
aaaccgtcatggaggatcctgaatgtccccgggaaaccgcctaagttagcttggggacat
agcacatgcgttgttggaggaactagagtattggtccttggtggtcacactggtgaggaa
tggatactcaatgaattacatgaactctgcttggctagccggcaagactcggatctgtaa

DBGET integrated database retrieval system