KEGG   Arabidopsis thaliana (thale cress): AT1G74090
Entry
AT1G74090         CDS       T00041                                 
Symbol
SOT18
Name
(RefSeq) desulfo-glucosinolate sulfotransferase 18
  KO
K22321  aliphatic desulfoglucosinolate sulfotransferase [EC:2.8.2.38]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00966  Glucosinolate biosynthesis
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    AT1G74090 (SOT18)
Enzymes [BR:ath01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.38  aliphatic desulfoglucosinolate sulfotransferase
     AT1G74090 (SOT18)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 Pyocin_S PG_1098_N
Other DBs
NCBI-GeneID: 843749
NCBI-ProteinID: NP_177549
TAIR: AT1G74090
UniProt: Q9C9C9 A0A654ENT6 T1P4U2
LinkDB
Position
1:27862814..27864193
AA seq 350 aa
MESETLTAKATITTTTLPSHDETKTESTEFEKNQKRYQDLISTFPHEKGWRPKEPLIEYG
GYWWLPSLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAIANRSRFDDSSNPLL
KRNPHEFVPYIEIDFPFFPEVDVLKDKGNTLFSTHIPYELLPDSVVKSGCKMVYIWREPK
DTFISMWTFLHKERTELGPVSNLEESFDMFCRGLSGYGPYLNHILAYWKAYQENPDRILF
LKYETMRADPLPYVKSLAEFMGHGFTAEEEEKGVVEKVVNLCSFETLKNLEANKGEKDRE
DRPGVYANSAYFRKGKVGDWSNYLTPEMAARIDGLMEEKFKGTGLLEHGK
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggaatcagaaaccctaaccgccaaggctacgatcacgaccacgaccctaccgagtcac
gacgagaccaagacagaatcaacagagttcgagaaaaatcaaaaacggtatcaagacctc
atctccacgtttcctcacgagaaaggctggagaccgaaagagcccctgatcgagtatggt
ggttactggtggctaccgtctctcctcgaaggttgtattcacgcgcaagagttctttcaa
gcacgacccagtgacttcctcgtctgtagctacccaaagacaggcaccacttggctcaaa
gccctgactttcgccatcgcaaatcgttcccgcttcgatgattcctccaaccctctcctg
aaacgtaaccctcacgagtttgttccttacattgagatagatttccctttcttccctgaa
gttgatgttctcaaagacaaagggaacactctgttttcgactcatatcccatacgagtta
ttacctgattcggttgtgaaatccggttgtaagatggtttacatatggagagaaccaaag
gacactttcatctccatgtggactttccttcacaaggaaaggacagagcttggacctgtc
agcaatcttgaggagtcttttgatatgttctgtcgtggtctgtctgggtatggtccttat
cttaatcatatcctggcgtattggaaagcataccaagagaatccagataggatcttgttc
ctcaagtacgagacgatgagagctgatcctttaccgtacgtgaagagtctggctgagttt
atgggtcatggattcacagccgaggaagaggagaaaggtgttgttgagaaagtggtgaat
ctttgcagcttcgagacgttgaagaatcttgaagctaacaaaggggagaaagacagagag
gatcgtcctggtgtttacgcgaatagcgcgtatttcaggaaaggaaaggtgggagattgg
tcgaactatctgactccggagatggctgctcgtatagatgggttaatggaagagaaattt
aagggcaccggcttgcttgaacatggtaaatga

DBGET integrated database retrieval system