Arabidopsis thaliana (thale cress): AT2G03170 Help Entry AT2G03170         CDS       T00041                                  Symbol SK14 Name (RefSeq) SKP1-like 14   KO K03094   S-phase kinase-associated protein 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath03083   Polycomb repressive complex ath04120   Ubiquitin mediated proteolysis ath04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AT2G03170 (SK14)    04120 Ubiquitin mediated proteolysis     AT2G03170 (SK14)   09126 Chromosome    03083 Polycomb repressive complex     AT2G03170 (SK14)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT2G03170 (SK14)    04121 Ubiquitin system [BR:ath04121]     AT2G03170 (SK14)    03036 Chromosome and associated proteins [BR:ath03036]     AT2G03170 (SK14) Membrane trafficking [BR:ath04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     AT2G03170 (SK14) Ubiquitin system [BR:ath04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      AT2G03170 (SK14)    Cul7 complex      AT2G03170 (SK14) Chromosome and associated proteins [BR:ath03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      AT2G03170 (SK14)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      AT2G03170 (SK14) SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ EMARD_N Motif Other DBs NCBI-GeneID:  814846 NCBI-ProteinID:  NP_565296 TAIR:  AT2G03170 UniProt:  O81057 LinkDB All DBs Position 2:961308..961771 Genome browser AA seq 149 aa AA seqDB search MSSNKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTEVPLQNVTGKILSIVVEYCK KHVVDEESDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPE EIREIFNIENDFTPEEEAAVRKENAWAFE NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgtcttccaacaagattgttttgtctagctccgatggcgaatctttcgaggttgaagaa gcggtggcaagaaaactgaaaatcgtggaacacatgattgaagacgactgtgttgttacc gaggtccctcttcaaaacgtcaccggaaagatcctctccattgttgtcgagtattgcaag aaacacgtcgttgacgaagaaagcgacgagttcaagacttgggacgaagagttcatgaag aaatttgatcagcctacggtcttccaactcttgctcgctgctaactatctcaatatcaaa ggccttcttgatctctctgctcaaaccgttgcagatcgcatcaaagataagactccagag gaaattcgagaaatcttcaacatcgagaacgatttcacacccgaagaagaagcagcggtt cgcaaggaaaacgcatgggcttttgaatag

DBGET integrated database retrieval system