Arabidopsis thaliana (thale cress): AT2G17800 Help Entry AT2G17800         CDS       T00041                                  Symbol ARAC1 Name (RefSeq) RAC-like 1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath04145   Phagosome ath04148   Efferocytosis ath04517   IgSF CAM signaling ath04518   Integrin signaling ath04620   Toll-like receptor signaling pathway ath05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ath00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     AT2G17800 (ARAC1)    04518 Integrin signaling     AT2G17800 (ARAC1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     AT2G17800 (ARAC1)    04148 Efferocytosis     AT2G17800 (ARAC1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     AT2G17800 (ARAC1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     AT2G17800 (ARAC1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT2G17800 (ARAC1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ath04147]     AT2G17800 (ARAC1)    04031 GTP-binding proteins [BR:ath04031]     AT2G17800 (ARAC1) Membrane trafficking [BR:ath04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     AT2G17800 (ARAC1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     AT2G17800 (ARAC1)   Macropinocytosis    Ras GTPases     AT2G17800 (ARAC1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     AT2G17800 (ARAC1) Exosome [BR:ath04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AT2G17800 (ARAC1)   Exosomal proteins of other body fluids (saliva and urine)    AT2G17800 (ARAC1)   Exosomal proteins of colorectal cancer cells    AT2G17800 (ARAC1)   Exosomal proteins of bladder cancer cells    AT2G17800 (ARAC1) GTP-binding proteins [BR:ath04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     AT2G17800 (ARAC1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  816290 NCBI-ProteinID:  NP_001077910 TAIR:  AT2G17800 UniProt:  Q38902 A0A178VRA4 LinkDB All DBs Position 2:7739787..7742280 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL DLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVLQP PKQKKKKSKAQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcttcgaggttcataaagtgtgtcaccgttggcgacggagctgttggtaaaacc tgtttgctgatttcttacaccagcaacacttttcctacggattatgtaccgactgttttc gataactttagcgcaaatgtggttgttaatggagccactgtgaatcttgggctatgggat accgcagggcaggaggattataacagattaagacctttgagttaccgcggtgctgatgtt ttcatcttagcattctctcttatcagtaaggctagttatgagaatgtctccaagaagtgg atcccagagctgaagcattatgcccctggtgtccctatagttcttgttggaaccaaacta gatcttcgggatgacaaacagttcttcattgaccaccctggcgctgtaccaattactact gctcagggagaggaactgaagaaactaattggagctcccgcatacatcgagtgcagttca aaaacacaagagaacgtgaaaggagtatttgatgcagcgatccgagtggttcttcaacct ccaaagcagaagaaaaagaaaagcaaagcacaaaaagcctgctccattttgtaa

DBGET integrated database retrieval system