KEGG   Arabidopsis thaliana (thale cress): AT2G18790
Entry
AT2G18790         CDS       T00041                                 

Symbol
PHYB
Name
(RefSeq) phytochrome B
  KO
K12121  phytochrome B
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G18790 (PHYB)
SSDB
Motif
Pfam: PHY PAS PAS_2 GAF HisKA HATPase_c PAS_9 PAS_4 PAS_8 PAS_3 sCache_3_2
Other DBs
NCBI-GeneID: 816394
NCBI-ProteinID: NP_179469
TAIR: AT2G18790
UniProt: P14713 A0A178W0V4
LinkDB
Structure
PDB: 
4OUR

Position
2:8139756..8144461
AA seq 1172 aa
MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSLRPRSNTESMSKAIQQ
YTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQQITAYLSRIQRGGYIQPFGCM
IAVDESSFRIIGYSENAREMLGIMPQSVPTLEKPEILAMGTDVRSLFTSSSSILLERAFV
AREITLLNPVWIHSKNTGKPFYAILHRIDVGVVIDLEPARTEDPALSIAGAVQSQKLAVR
AISQLQALPGGDIKLLCDTVVESVRDLTGYDRVMVYKFHEDEHGEVVAESKRDDLEPYIG
LHYPATDIPQASRFLFKQNRVRMIVDCNATPVLVVQDDRLTQSMCLVGSTLRAPHGCHSQ
YMANMGSIASLAMAVIINGNEDDGSNVASGRSSMRLWGLVVCHHTSSRCIPFPLRYACEF
LMQAFGLQLNMELQLALQMSEKRVLRTQTLLCDMLLRDSPAGIVTQSPSIMDLVKCDGAA
FLYHGKYYPLGVAPSEVQIKDVVEWLLANHADSTGLSTDSLGDAGYPGAAALGDAVCGMA
VAYITKRDFLFWFRSHTAKEIKWGGAKHHPEDKDDGQRMHPRSSFQAFLEVVKSRSQPWE
TAEMDAIHSLQLILRDSFKESEAAMNSKVVDGVVQPCRDMAGEQGIDELGAVAREMVRLI
ETATVPIFAVDAGGCINGWNAKIAELTGLSVEEAMGKSLVSDLIYKENEATVNKLLSRAL
RGDEEKNVEVKLKTFSPELQGKAVFVVVNACSSKDYLNNIVGVCFVGQDVTSQKIVMDKF
INIQGDYKAIVHSPNPLIPPIFAADENTCCLEWNMAMEKLTGWSRSEVIGKMIVGEVFGS
CCMLKGPDALTKFMIVLHNAIGGQDTDKFPFPFFDRNGKFVQALLTANKRVSLEGKVIGA
FCFLQIPSPELQQALAVQRRQDTECFTKAKELAYICQVIKNPLSGMRFANSLLEATDLNE
DQKQLLETSVSCEKQISRIVGDMDLESIEDGSFVLKREEFFLGSVINAIVSQAMFLLRDR
GLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRYAPSQEWVEIHLSQLSKQMADGF
AAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGLGLSVCRKILKLMNGEVQYIRESER
SYFLIILELPVPRKRPLSTASGSGDMMLMMPY
NT seq 3519 nt   +upstreamnt  +downstreamnt
atggtttccggagtcgggggtagtggcggtggccgtggcggtggccgtggcggagaagaa
gaaccgtcgtcaagtcacactcctaataaccgaagaggaggagaacaagctcaatcgtcg
ggaacgaaatctctcagaccaagaagcaacactgaatcaatgagcaaagcaattcaacag
tacaccgtcgacgcaagactccacgccgttttcgaacaatccggcgaatcagggaaatca
ttcgactactcacaatcactcaaaacgacgacgtacggttcctctgtacctgagcaacag
atcacagcttatctctctcgaatccagcgaggtggttacattcagcctttcggatgtatg
atcgccgtcgatgaatccagtttccggatcatcggttacagtgaaaacgccagagaaatg
ttagggattatgcctcaatctgttcctactcttgagaaacctgagattctagctatggga
actgatgtgagatctttgttcacttcttcgagctcgattctactcgagcgtgctttcgtt
gctcgagagattaccttgttaaatccggtttggatccattccaagaatactggtaaaccg
ttttacgccattcttcataggattgatgttggtgttgttattgatttagagccagctaga
actgaagatcctgcgctttctattgctggtgctgttcaatcgcagaaactcgcggttcgt
gcgatttctcagttacaggctcttcctggtggagatattaagcttttgtgtgacactgtc
gtggaaagtgtgagggacttgactggttatgatcgtgttatggtttataagtttcatgaa
gatgagcatggagaagttgtagctgagagtaaacgagatgatttagagccttatattgga
ctgcattatcctgctactgatattcctcaagcgtcaaggttcttgtttaagcagaaccgt
gtccgaatgatagtagattgcaatgccacacctgttcttgtggtccaggacgataggcta
actcagtctatgtgcttggttggttctactcttagggctcctcatggttgtcactctcag
tatatggctaacatgggatctattgcgtctttagcaatggcggttataatcaatggaaat
gaagatgatgggagcaatgtagctagtggaagaagctcgatgaggctttggggtttggtt
gtttgccatcacacttcttctcgctgcataccgtttccgctaaggtatgcttgtgagttt
ttgatgcaggctttcggtttacagttaaacatggaattgcagttagctttgcaaatgtca
gagaaacgcgttttgagaacgcagacactgttatgtgatatgcttctgcgtgactcgcct
gctggaattgttacacagagtcccagtatcatggacttagtgaaatgtgacggtgcagca
tttctttaccacgggaagtattacccgttgggtgttgctcctagtgaagttcagataaaa
gatgttgtggagtggttgcttgcgaatcatgcggattcaaccggattaagcactgatagt
ttaggcgatgcggggtatcccggtgcagctgcgttaggggatgctgtgtgcggtatggca
gttgcatatatcacaaaaagagactttcttttttggtttcgatctcacactgcgaaagaa
atcaaatggggaggcgctaagcatcatccggaggataaagatgatgggcaacgaatgcat
cctcgttcgtcctttcaggcttttcttgaagttgttaagagccggagtcagccatgggaa
actgcggaaatggatgcgattcactcgctccagcttattctgagagactcttttaaagaa
tctgaggcggctatgaactctaaagttgtggatggtgtggttcagccatgtagggatatg
gcgggggaacaggggattgatgagttaggtgcagttgcaagagagatggttaggctcatt
gagactgcaactgttcctatattcgctgtggatgccggaggctgcatcaatggatggaac
gctaagattgcagagttgacaggtctctcagttgaagaagctatggggaagtctctggtt
tctgatttaatatacaaagagaatgaagcaactgtcaataagcttctttctcgtgctttg
agaggggacgaggaaaagaatgtggaggttaagctgaaaactttcagccccgaactacaa
gggaaagcagtttttgtggttgtgaatgcttgttccagcaaggactacttgaacaacatt
gtcggcgtttgttttgttggacaagacgttactagtcagaaaatcgtaatggataagttc
atcaacatacaaggagattacaaggctattgtacatagcccaaaccctctaatcccgcca
atttttgctgctgacgagaacacgtgctgcctggaatggaacatggcgatggaaaagctt
acgggttggtctcgcagtgaagtgattgggaaaatgattgtcggggaagtgtttgggagc
tgttgcatgctaaagggtcctgatgctttaaccaagttcatgattgtattgcataatgcg
attggtggccaagatacggataagttccctttcccattctttgaccgcaatgggaagttt
gttcaggctctattgactgcaaacaagcgggttagcctcgagggaaaggttattggggct
ttctgtttcttgcaaatcccgagccctgagctgcagcaagctttagcagtccaacggagg
caggacacagagtgtttcacgaaggcaaaagagttggcttatatttgtcaggtgataaag
aatcctttgagcggtatgcgtttcgcaaactcattgttggaggccacagacttgaacgag
gaccagaagcagttacttgaaacaagtgtttcttgcgagaaacagatctcaaggatcgtc
ggggacatggatcttgaaagcattgaagacggttcatttgtgctaaagagggaagagttt
ttccttggaagtgtcataaacgcgattgtaagtcaagcgatgttcttattaagggacaga
ggtcttcagctgatccgtgacattcccgaagagatcaaatcaatagaggtttttggagac
cagataaggattcaacagctcctggctgagtttctgctgagtataatccggtatgcacca
tctcaagagtgggtggagatccatttaagccaactttcaaagcaaatggctgatggattc
gccgccatccgcacagaattcagaatggcgtgtccaggtgaaggtctgcctccagagcta
gtccgagacatgttccatagcagcaggtggacaagccctgaaggtttaggtctaagcgta
tgtcgaaagattttaaagctaatgaacggtgaggttcaatacatccgagaatcagaacgg
tcctatttcctcatcattctggaactccctgtacctcgaaagcgaccattgtcaactgct
agtggaagtggtgacatgatgctgatgatgccatattag

DBGET integrated database retrieval system