Arabidopsis thaliana (thale cress): AT2G25700 Help Entry AT2G25700         CDS       T00041                                  Symbol SK3 Name (RefSeq) SKP1-like 3   KO K03094   S-phase kinase-associated protein 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath03083   Polycomb repressive complex ath04120   Ubiquitin mediated proteolysis ath04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AT2G25700 (SK3)    04120 Ubiquitin mediated proteolysis     AT2G25700 (SK3)   09126 Chromosome    03083 Polycomb repressive complex     AT2G25700 (SK3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT2G25700 (SK3)    04121 Ubiquitin system [BR:ath04121]     AT2G25700 (SK3)    03036 Chromosome and associated proteins [BR:ath03036]     AT2G25700 (SK3) Membrane trafficking [BR:ath04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     AT2G25700 (SK3) Ubiquitin system [BR:ath04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      AT2G25700 (SK3)    Cul7 complex      AT2G25700 (SK3) Chromosome and associated proteins [BR:ath03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      AT2G25700 (SK3)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      AT2G25700 (SK3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  817111 NCBI-ProteinID:  NP_565604 TAIR:  AT2G25700 UniProt:  Q9SL93 A0A5S9X1C2 LinkDB All DBs Position 2:complement(10948747..10949626) Genome browser AA seq 163 aa AA seqDB search MAETKKMIILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNGIPLPNVTGAILAKVIEY CKKHVEAAAEAGGDKDFYGSTENHELKTWDNDFVKVDHPTLFDLLRAANYLNISGLLDLT CKAVADQMRGKTPAQMREHFNIKNDYTPEEEAEVRNENRWAFE NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atggcagaaacgaagaagatgatcatcctcaagagctccgacggtgaatccttcgaggtc gaggaagccgtcgcggtcgagtcccagacgattaagcacatgatcgaggacgactgcgtc gataacggaattccacttcccaatgtcaccggagccatcctcgcgaaggttatcgagtac tgcaagaaacacgttgaagccgctgctgaggctggtggagacaaggatttctatggttcc accgagaaccacgagctcaagacttgggacaacgatttcgtcaaagttgatcatcctact ctcttcgatctccttcgggctgccaactatttgaacatcagtggacttcttgaccttacg tgcaaggccgtggctgatcagatgagaggcaaaactccagcgcagatgcgtgaacacttc aacatcaagaacgactacacacctgaggaagaggccgaggttcgcaatgagaacaggtgg gcgttcgagtga

DBGET integrated database retrieval system