KEGG   Arabidopsis thaliana (thale cress): AT2G25930
Entry
AT2G25930         CDS       T00041                                 
Symbol
ELF3
Name
(RefSeq) hydroxyproline-rich glycoprotein family protein
  KO
K12125  protein EARLY FLOWERING 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G25930 (ELF3)
SSDB
Motif
Pfam: 4_1_CTD
Other DBs
NCBI-GeneID: 817134
NCBI-ProteinID: NP_180164
TAIR: AT2G25930
UniProt: O82804
LinkDB
Position
2:11058944..11063324
AA seq 695 aa
MKRGKDEEKILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTMNSRSN
NTSTLVHPGPSSQPCGVERNLSVQHLDSSAANQATEKFVSQMSFMENVRSSAQHDQRKMV
REEEDFAVPVYINSRRSQSHGRTKSGIEKEKHTPMVAPSSHHSIRFQEVNQTGSKQNVCL
ATCSKPEVRDQVKANARSGGFVISLDVSVTEEIDLEKSASSHDRVNDYNASLRQESRNRL
YRDGGKTRLKDTDNGAESHLATENHSQEGHGSPEDIDNDREYSKSRACASLQQINEEASD
DVSDDSMVDSISSIDVSPDDVVGILGQKRFWRARKAIANQQRVFAVQLFELHRLIKVQKL
IAASPDLLLDEISFLGKVSAKSYPVKKLLPSEFLVKPPLPHVVVKQRGDSEKTDQHKMES
SAENVVGRLSNQGHHQQSNYMPFANNPPASPAPNGYCFPPQPPPSGNHQQWLIPVMSPSE
GLIYKPHPGMAHTGHYGGYYGHYMPTPMVMPQYHPGMGFPPPGNGYFPPYGMMPTIMNPY
CSSQQQQQQQPNEQMNQFGHPGNLQNTQQQQQRSDNEPAPQQQQQPTKSYPRARKSRQGS
TGSSPSGPQGISGSKSFRPFAAVDEDSNINNAPEQTMTTTTTTTRTTVTQTTRDGGGVTR
VIKVVPHNAKLASENAARIFQSIQEERKRYDSSKP
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgaagagagggaaagatgaggagaagatattggaacctatgtttcctcggcttcatgtg
aatgatgcagataaaggagggcctagagctcctcctagaaacaagatggctctttatgag
cagcttagtattccttctcagaggtttggtgatcatggaacgatgaattctcgtagtaac
aacacaagcactttggttcatcctggaccatctagtcagccttgtggtgtggaaagaaac
ttatctgtccagcatcttgattcttcagccgcaaaccaagcaactgagaagtttgtctcc
caaatgtccttcatggaaaatgtgagatcttcggcacagcatgatcagaggaaaatggtg
agagaggaagaagattttgcagttccagtatatattaactcaagaagatctcagtctcat
ggcagaaccaagagtggtattgagaaggaaaaacacaccccaatggtggcacctagctct
catcactccattcgatttcaagaagtgaatcagacaggctcaaagcaaaacgtatgtttg
gctacttgttcaaaacctgaagttagggatcaggtcaaggcgaatgcaaggtcaggtggc
tttgtaatctctttagatgtatcagtcacagaggagattgatctcgaaaaatcagcatca
agtcatgatagagtaaatgattataatgcttccttgagacaagagtctagaaatcggtta
taccgagatggtggcaaaactcgtctgaaggacactgataatggagctgaatctcacttg
gcaacggaaaatcattcacaagagggtcatggcagtcctgaagacattgataatgatcgt
gaatacagcaaaagcagagcatgcgcctctctgcagcagataaatgaagaggcaagtgat
gacgtttctgatgattcgatggtggattctatatccagcatagatgtctctcccgatgat
gttgtgggtatattaggtcaaaaacgtttctggagagcaaggaaagccattgccaatcaa
caaagagtatttgctgttcaactatttgagttgcacagactgattaaggttcaaaaactt
attgctgcatcaccggatctcttgctcgatgagatcagttttcttggaaaagtttctgct
aaaagctatccagtgaagaagctccttccatcagaatttctggtaaagcctcctctacca
catgttgtcgtcaaacaaaggggtgactcggagaagactgaccaacataaaatggaaagc
tcagctgagaacgtagttgggaggttgtcaaatcaaggtcatcatcaacaatccaactac
atgccttttgcaaacaacccaccggcttcaccggctccaaatggatattgctttcctcct
cagcctcctccttcaggaaatcatcagcaatggttgatccctgtaatgtctccctcggaa
ggactgatatacaagcctcacccaggtatggcacacacggggcattatggaggatattat
ggtcattatatgcctacaccaatggtaatgcctcaatatcaccccggcatgggattccca
cctcctggtaatggctacttccctccatatggaatgatgcccaccataatgaacccatat
tgttcaagccaacaacaacaacaacaacaacccaatgagcaaatgaaccagtttggacat
cctggaaatcttcagaacacccaacaacaacaacagagatctgataatgaacctgctcca
cagcaacagcaacagccaacaaagtcttatccgcgagcaagaaagagcaggcaagggagc
acaggaagcagtccaagtgggccacagggaatctctggtagcaagtcctttcggccattc
gcagccgttgatgaggacagcaacatcaacaatgcacctgagcaaacgatgacaacaacc
acaacgacgacaagaacaactgttactcagacaacaagagatgggggaggagtgacgaga
gtgataaaggtggtacctcacaacgcaaagctcgcgagtgagaatgctgccagaattttc
cagtcaatacaagaagaacgtaaacgctatgactcctctaagccttaa

DBGET integrated database retrieval system