KEGG   Arabidopsis thaliana (thale cress): AT2G26800
Entry
AT2G26800         CDS       T00041                                 
Name
(RefSeq) Aldolase superfamily protein
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00280  Valine, leucine and isoleucine degradation
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath04146  Peroxisome
Module
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT2G26800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT2G26800
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G26800
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     AT2G26800
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-GeneID: 817221
NCBI-ProteinID: NP_001324446
TAIR: AT2G26800
UniProt: O81027
LinkDB
Position
2:complement(11429019..11432797)
AA seq 468 aa
MQWNGVRRAHSIWCKRLTNNTHLHHPSIPVSHFFTMSSLEEPLSFDKLPSMSTMDRIQRF
SSGACRPRDDVGMGHRWIEGRDCTTSNSCIDDDKSFAKESFPWRRHTRKLSEGEHMFRNI
SFAGRTSTVSGTLRESKSFKEQKYSTFSNENGTSHISNKISKGIPKFVKIVEVGPRDGLQ
NEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWVPQLADAKDVMDAVNTLDGARLPV
LTPNLKGFQAAVSAGAKEVAIFASASESFSLSNINCTIEESLLRYRVVATAAKEHSVPVR
GYVSCVVGCPVEGPVLPSKVAYVVKELYDMGCFEISLGDTIGIGTPGSVVPMLEAVMAVV
PADKLAVHFHDTYGQALANILVSLQMGISIVDSSIAGLGGCPYAKGASGNVATEDVVYML
NGLGVHTNVDLGKLIAAGDFISKHLGRPNGSKAAVALNRRITADASKI
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcaatggaatggggtgagacgagcccattctatatggtgcaagagattaacaaacaac
actcatttgcatcatccttctattccagtctcacattttttcaccatgtcgagtttggag
gagccgctaagctttgacaagttgccaagtatgagcactatggataggattcagagattt
tcttccggtgcttgtcgccccagggatgatgtcggtatgggacaccgttggattgaagga
agagattgcactacctctaacagttgcattgatgatgataaaagctttgctaaagagtca
ttcccgtggagaaggcatactcggaaattatctgaaggagagcatatgtttaggaatatt
tcgtttgctggaaggacttctactgtttctgggactttaagggaatccaaaagttttaag
gagcagaagtatagcacatttagcaatgagaatggcacgtcgcatataagtaataagatc
tctaaaggtataccaaagtttgtgaagattgtagaagttggtccaagagatggcctgcag
aatgagaaaaatatagtacccacatctgtaaaggtggaactaattcagagattagtttct
tctggattgcctgttgtcgaggctacaagttttgtatcaccaaagtgggttccccagctt
gcagatgcaaaggatgtaatggatgcagtaaatactttagatggggctcgattaccggtt
ctgacaccgaatctaaaaggctttcaagcggctgtatctgcaggtgcaaaggaagttgca
atctttgcatcggcttctgagtcattctccttgtcaaatattaactgtaccatcgaagag
agtctcttgagatatcgtgttgttgccactgctgcaaaggagcattcggttccagtccgt
gggtatgtatcttgcgttgtggggtgtccagtagagggacctgttctaccctcaaaagtg
gcttatgttgtgaaagaactctatgacatgggctgctttgagatttctctgggtgataca
attggaatcggcactcctggttctgtggttccaatgcttgaagccgtgatggcagttgtg
ccagcggacaagctggctgttcacttccatgatacctatgggcaagctcttgcaaacata
ttggtgtctctccagatgggaataagcatagtagactcatcaattgccggattaggcggc
tgcccatatgcaaaaggagcttcaggaaatgtagccacagaagatgtggtttacatgttg
aacggtttaggcgtccacaccaatgtcgacttgggaaagcttatagctgctggagatttc
atcagcaagcatctcggtcgtcccaatggttcgaaggctgccgttgccctcaaccgtcgt
atcacagctgatgcctccaagatatga

DBGET integrated database retrieval system