KEGG   Arabidopsis thaliana (thale cress): AT2G31260
Entry
AT2G31260         CDS       T00041                                 
Symbol
APG9
Name
(RefSeq) autophagy 9 (APG9)
  KO
K17907  autophagy-related protein 9
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT2G31260 (APG9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT2G31260 (APG9)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT2G31260 (APG9)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   ATG9 transmembrane protein
    AT2G31260 (APG9)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT2G31260 (APG9)
SSDB
Motif
Pfam: ATG9
Other DBs
NCBI-GeneID: 817683
NCBI-ProteinID: NP_850164
TAIR: AT2G31260
UniProt: Q8RUS5 A0A178W047
LinkDB
Position
2:complement(13321833..13327496)
AA seq 866 aa
MMSSGHKGPNVRNFFKWQRGESSSSLTTGLLHNESHEIELSNYGGIPSPGSESPSGLLNG
ESLNVQPIADLDLFVERLYSYYRDKGLWCIIVKWAVELLSLGFIICFSGFFLLYVDWNGL
QNAKCGMDAVESGTKPCDLVKEAIHPHPLSPFTLTTAIIVGYLALFSVYWLFCFLRFFAQ
LKDTLDFRHFYYNNLHVTDNEILTMPWATVLEKVVQLQSSQCLCVVKDLSAHDMVMRLMR
KENYLIGMLNKGLLSFPISHWIPGAGPAVKSAPDGTQYHLVLTKTLEWTLNWCILQSMFD
CNFRVRRDFVSNPTTLKKRLFVVGLAMLLLSPFLVIFMLVYLFLRHAEQFYNHPSTASSR
RWSNLSKWLFREFNEVDHLFKHRINSSVVHASEYLKQFPSPIISIIAKFVSFVSGGFAAV
LIIIAFLEESLLEGHIFGRNLFWYAAVFGTITAISRAAISDELLVLDPVGTMSLVVQNTH
YMPKRWRGKENKDDVRLELETLFQYTGMMLLEEIASIFITPFLLMFVVPKRVDDILQFIK
DFTVDIEGVGHVCSFSAFYFENHGNIKYGSPHNATRREQRSSQGKMEKSFLSFQSSYPSW
ESDSLGKQFLSNLRTFRDRKLHEINTRHSSPSRAWRESTNTPALYRDIPRNPLASGNHTD
SMWLIDPDQRNHPYLLDWYYTSQAHNRTDHPIERANEILTANQNATDCWPPDLGIRGEDS
RDLLNMEASTSGQFFRESILRHDQPEGEDSYGSQHPLDGRNQWWGRGNHSQISTAHPATT
NSFIEPPDFINRYTAGNLLDNSWSRRSIEEEDEEEEELDWEENARRNLSRTTFMDDNDIE
AGIDLHFDDVYSSRPQETSTSSTTLR
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgatgagcagtgggcataagggtccaaatgtacgtaacttttttaaatggcaacgtggt
gaatcatcatcgtctttgactactggattgcttcataatgagtcacacgagattgagcta
tctaactacggaggaataccaagtcctggtagtgagagcccatcgggacttcttaatgga
gagagtttaaatgttcaaccaattgctgatttggatctttttgtcgaaaggctctacagc
tactacagagacaaaggactttggtgtattatagtaaagtgggctgttgagcttctaagt
ctgggcttcatcatatgcttctctgggtttttcttgctgtatgttgattggaatggtctt
cagaatgcaaaatgtggaatggatgcagttgaatcaggaactaaaccatgtgatcttgtc
aaagaagctatccatccgcatcctttatcccctttcacgctcacaactgctataattgtt
ggatatttggccctcttctctgtgtactggctcttctgcttcttaaggttttttgcccag
ttgaaagatactttggactttcggcacttttattacaacaatctccatgtcacagacaat
gaaatccttactatgccatgggcaacagtccttgagaaggttgttcagttacaaagctca
caatgcctttgtgtggttaaggatctttctgctcatgatatggttatgcgccttatgcgg
aaagaaaactacttgattggaatgctcaacaaaggtttgctttctttcccaatttcccat
tggatccctggtgctggtccagcagtcaaatccgcaccagatgggacacagtatcacctt
gtattgacaaagacccttgagtggacccttaactggtgcatattgcagagcatgtttgac
tgcaattttcgtgttagaagggactttgtttcaaatcctacaacactgaagaaacgacta
tttgtggttgggcttgctatgcttctgctgtcaccgtttcttgtcatctttatgttggtg
tatttattcctaaggcatgctgaacagttctacaatcatccaagtactgcatcttctcga
agatggtccaatttgtcaaagtggctcttcagggaattcaatgaggttgaccatttattc
aagcatcggattaatagcagtgtagtacatgcatccgaatatctaaagcaatttccctcg
cctatcatctccattattgcaaagtttgtctcgtttgtttctggcggctttgctgctgtc
ttaatcatcattgcgtttcttgaagaatctctacttgagggacatatattcggccgcaat
ctgttctggtatgccgctgtttttggaacaattacagctattagtagagctgccatatcg
gatgaacttttggtcctcgacccagtaggaactatgtctttggtggtccaaaacactcat
tatatgcctaagagatggcgtggaaaggagaacaaggatgatgtccgcttggagttagag
actctgtttcagtatactggaatgatgctattggaggagatagcttcaatcttcatcaca
ccatttttgctgatgtttgtcgtgccaaagcgggtggatgacatcttgcaattcattaag
gatttcacagttgatattgaaggtgtaggccatgtttgcagctttagtgctttctacttt
gagaaccatggaaatatcaaatatggttcaccacataatgcaactcgtcgtgagcagaga
agctcacaagggaaaatggagaaatcattcttgagtttccagagtagttatccttcttgg
gagtcagattctcttgggaagcagtttctgtcaaatctcagaactttccgggaccgaaag
cttcatgaaataaacacaagacactcatctcctagtagggcgtggcgagaaagcactaat
acccctgctttatacagagacattccaagaaatccgcttgcgagcggcaatcacactgat
tcaatgtggctgattgatccagatcagaggaatcatccttatcttcttgactggtattac
acttctcaggctcacaacagaactgatcacccaatagagagagcaaatgaaatcttaacc
gcaaatcagaacgctacagattgttggcctcctgatttgggaatccgtggtgaagatagc
agagatctgctcaacatggaggcaagcacatcaggtcagtttttcagagagagcattctg
cgccatgaccaacccgagggagaggatagttatgggagtcagcatcctcttgatggtagg
aaccagtggtggggaagaggcaaccactctcagatcagcacagctcatcccgcaaccacc
aatagcttcatcgagccacctgattttataaaccgctacacagcaggaaacttattagac
aactcttggagcagaagaagcatagaagaagaagatgaagaagaagaagaattggattgg
gaagagaatgcaagaagaaatttgtcgagaactacattcatggacgataacgatatcgaa
gctgggattgatctccatttcgacgatgtatatagttcaagacctcaagaaacttcaaca
tcaagcaccacattacggtga

DBGET integrated database retrieval system