KEGG   Arabidopsis thaliana (thale cress): AT2G44680
Entry
AT2G44680         CDS       T00041                                 

Symbol
CKB4
Name
(RefSeq) casein kinase II beta subunit 4
  KO
K03115  casein kinase II subunit beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT2G44680 (CKB4)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G44680 (CKB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT2G44680 (CKB4)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT2G44680 (CKB4)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   Kinase
    AT2G44680 (CKB4)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     AT2G44680 (CKB4)
SSDB
Motif
Pfam: CK_II_beta MFMR_assoc PknG_rubred
Other DBs
NCBI-GeneID: 819076
NCBI-ProteinID: NP_181996
TAIR: AT2G44680
UniProt: O80507 A0A5S9X707
LinkDB
Position
2:complement(18426481..18428397)
AA seq 283 aa
MYKDRSGGGIMGGGGSSRSEILGGAIDRKRINDALDKHLKKSSPSTSRVFTSKDKDSVPS
TSTAKSQLHSRSPDVESDTDSEGSDVSGSEGDDTSWISWFCNLRGNEFFCEVDEDYIQDD
FNLCGLSGQVPYYDYALDLILDVESSNGDMFTEEQHEMVESAAEMLYGLIHVRYILTTKG
MAAMMEKYKNYDFGRCPRVFCCGQSCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGN
IDGAYFGTTFPHLFLMAYGNMKPQKPAQNYVPKIFGFKVHNKQ
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtacaaggatcggagtggaggaggaataatgggtggtggtggatcatcgagatcggag
atccttggtggagctattgatcggaaacgaatcaatgatgctttagacaaacatcttaag
aaatcttcaccttctacatctagggttttcacttctaaggacaaagattctgtcccttct
acttcaactgctaaatctcagcttcattctcgttcccccgatgttgaatctgacacggat
agtgaaggatcagatgtgagtggttcagaaggtgatgatacctcttggatctcatggttt
tgtaatttgagagggaatgagtttttctgtgaagtagatgaagattatatacaagatgat
ttcaatctctgtggtttgagtggtcaagttccttactatgattatgcacttgatctcatt
ttagatgttgaatcatcaaatggtgatatgtttactgaagaacagcatgagatggtggaa
tcagctgctgagatgttatatggtcttattcatgttcgttatattctcactactaaagga
atggctgctatgatggagaagtataagaattatgatttcgggagatgccccagagttttc
tgttgcggacagtcttgtcttccggttggccaatctgatatcccgaggtcgagcactgtg
aagatatactgcccaaaatgcgaggatatttactacccgcgatctaaataccaaggcaac
attgatggagcttactttggaactactttccctcatttgtttctcatggcctatgggaac
atgaaaccgcagaagccggctcaaaactacgttcctaagatctttggctttaaggtacac
aacaaacaatga

KEGG   Arabidopsis thaliana (thale cress): AT3G60250
Entry
AT3G60250         CDS       T00041                                 

Symbol
CKB3
Name
(RefSeq) casein kinase II beta chain 3
  KO
K03115  casein kinase II subunit beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT3G60250 (CKB3)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT3G60250 (CKB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT3G60250 (CKB3)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT3G60250 (CKB3)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   Kinase
    AT3G60250 (CKB3)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     AT3G60250 (CKB3)
SSDB
Motif
Pfam: CK_II_beta
Other DBs
NCBI-GeneID: 825196
NCBI-ProteinID: NP_191584
TAIR: AT3G60250
UniProt: O81275 A0A5S9XN65
LinkDB
Position
3:complement(22270270..22272173)
AA seq 276 aa
MYKERSGGGGGGSSRSEILGGAIDRKRINDALNKKLEKSSTSTTTSRVFSSKDKDPFSFT
STKTQLPDVESETDSEGSDVSGSEGDDTSWISWFCNLRGNDFFCEVDEDYIQDDFNLCGL
SGQVPYYDYALDLILDVDASNSEMFTDEQHEMVESAAEMLYGLIHVRYILTTKGMAAMTE
KYKNCDFGRCPRVFCCGQSCLPVGQSDIPRSSTVKIYCPKCEDISYPRSKFQGNIDGAYF
GTTFPHLFLMTYGNLKPQKPTQSYVPKIFGFKVHKP
NT seq 831 nt   +upstreamnt  +downstreamnt
atgtacaaggaacgtagtggaggaggtggtggtgggtcatcgagatcagagatcctcggt
ggagctattgatcggaaacgaatcaacgatgcactcaataagaaactagagaaatcttca
acttccaccaccacatctagggttttctcttctaaagacaaagatcccttttccttcaca
tctactaaaactcagcttcctgatgtggaatcggaaactgatagtgaagggtctgatgtg
agtggatcggagggtgatgatacgtcgtggatctcttggttttgtaatttgagagggaat
gatttcttctgtgaagtcgatgaagattatattcaagatgatttcaatctttgtggttta
agtggtcaagtcccttactatgattatgcacttgatctcattttagatgttgatgcttcc
aacagtgagatgtttactgatgaacagcatgaaatggtggaatcagctgctgagatgcta
tatggtcttattcatgttcgttacattttgactactaaaggaatggctgcaatgactgag
aagtacaagaactgtgatttcgggagatgcccgagagttttctgttgcggtcagtcttgt
cttccagttggacaatccgatatcccgagatcgagtactgtgaagatatactgccctaaa
tgcgaggatatatcttacccgcgatctaaattccaaggcaatattgatggagcgtacttt
ggaaccacattccctcacttgttcttgatgacttacgggaacttaaagccgcagaagcct
actcaaagctatgtcccaaaaatctttggcttcaaggtacacaaaccatga

KEGG   Arabidopsis thaliana (thale cress): AT4G17640
Entry
AT4G17640         CDS       T00041                                 

Symbol
CKB2
Name
(RefSeq) casein kinase II beta chain 2
  KO
K03115  casein kinase II subunit beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT4G17640 (CKB2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT4G17640 (CKB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT4G17640 (CKB2)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT4G17640 (CKB2)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   Kinase
    AT4G17640 (CKB2)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     AT4G17640 (CKB2)
SSDB
Motif
Pfam: CK_II_beta
Other DBs
NCBI-GeneID: 827484
NCBI-ProteinID: NP_193499
TAIR: AT4G17640
UniProt: P40229 A0A178UV49
LinkDB
Position
4:9825145..9827357
AA seq 282 aa
MYRERGMVGSKSEVVDRKRINEIHDNRPSHSMSQPVNGKGKVTSTSVLMGKQQLHDKESS
RSGSISKTNISDAVDISDTDSEESEVSGSDGEDTSWISWFCNLRGNEFFCEVDDDYIQDD
FNLCGLSHQVPYYDYALDLILDVESSHGEMFTEEQNELIESAAEMLYGMIHARFILTSKG
LASMLDKYKNYDFGRCPRVYCCGQPCLPVGQSDIPRASTVKIYCPKCEDVYYPRSKYQGN
IDGAYFGTTFPHLFLMTYGHLKPQKASQSYTQRVFGFKLHKP
NT seq 849 nt   +upstreamnt  +downstreamnt
atgtatagggagagaggtatggttggatcgaagtcggaggtggtcgatcggaaacgaata
aacgagattcacgataacaggccttcgcattcgatgtctcagcctgtcaatggaaaaggc
aaggtaacatcgacctccgttttgatggggaagcagcaattgcatgataaggaatcttca
cgttctggttctatctctaagactaacatttccgacgctgtggatatatcagacacagac
agcgaagaatcagaggtcagtggttctgatggagaggacacctcgtggatatcttggttc
tgcaaccttcgtgggaacgagttcttctgtgaagttgatgatgattacatccaggatgac
tttaacttgtgtggactcagccatcaagttccttactacgactatgcccttgatttgatt
ttggatgtggagtcttcgcatggtgagatgtttacagaggaacagaatgaattgatcgag
tcagcagcagagatgctatatggaatgattcatgctcgtttcatattgactagcaaaggg
ctggcttctatgttagacaaatacaaaaactatgactttggaagatgcccaagagtttat
tgttgtggccaaccttgtttaccagttggtcaatccgatatccctagagcaagcaccgta
aagatatactgcccaaaatgtgaagatgtctattacccacgatcaaaataccaaggaaac
atagatggagcttactttgggacaacgtttccacatctgttcttgatgacgtacgggcat
ctgaagccacaaaaggcatcacaaagctacactcaaagagtgtttgggttcaagctacac
aagccgtga

KEGG   Arabidopsis thaliana (thale cress): AT5G47080
Entry
AT5G47080         CDS       T00041                                 

Symbol
CKB1
Name
(RefSeq) casein kinase II beta chain 1
  KO
K03115  casein kinase II subunit beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT5G47080 (CKB1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G47080 (CKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT5G47080 (CKB1)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT5G47080 (CKB1)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   Kinase
    AT5G47080 (CKB1)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     AT5G47080 (CKB1)
SSDB
Motif
Pfam: CK_II_beta
Other DBs
NCBI-GeneID: 834754
NCBI-ProteinID: NP_199519
TAIR: AT5G47080
UniProt: P40228 A0A5S9YCV4
LinkDB
Position
5:complement(19124563..19126694)
AA seq 287 aa
MYRDRGTVNSRPEVVDRKRINDALERPSPSTSRQVNGKGKGTVTAATTTANLIGKQQSNN
INHRDSRSASLSKNNTVSDDESDTDSEESDVSGSDGEDTSWISWFCNLRGNEFFCEVDDD
YIQDDFNLCGLSSLVPYYEYALDLILDVESSQGEMFTEEQNELIESAAEMLYGLIHARYI
LTSKGLAAMLDKYKNYDFGRCPRVYCCGQPCLPVGQSDLPRSSTVKIYCPKCEDIYYPRS
KYQGNIDGAYFGTTFPHLFLMTYGHLKPAKATQNYVQRVFGFKLHKP
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtatagagacagaggaacggtgaattcgagacctgaagttgtggatcgtaaacggatc
aacgacgctcttgaacgtccttctccttcaacctctcgtcaagttaacggcaaaggcaaa
ggaaccgttacggcggcgacgacgacggcgaacttgattgggaagcagcagtcgaataac
atcaaccatagagattctcgttctgcttctctctcgaagaacaatacggtttctgatgat
gaatcagacacagatagtgaagaatcagatgtgagtggttctgatggagaggacacttca
tggatatcttggttttgtaatctaagaggaaacgagttcttttgtgaagttgatgatgat
tacattcaagatgacttcaacttgtgtggactcagcagtctagttccctactacgagtac
gctcttgatttgattttggatgttgaatcttctcaaggagagatgtttacagaggaacag
aatgaattgatcgagtcagcagctgagatgttgtatggactgattcatgctcgttacata
ttgactagcaaaggattggcagcaatgttagacaaatacaaaaactatgactttggaaga
tgtccaagagtttattgctgtggccaaccttgtcttccggttggtcaatcagacttaccg
cgatctagcactgtgaagatatattgcccgaaatgcgaagacatttattacccacgatca
aagtatcaaggcaacattgatggagcttactttgggacaacgtttccacatctgttcctg
atgacttatgggcatctcaagccagcgaaggcaacacaaaactatgttcaaagagtgttt
gggttcaaattacacaaaccgtga

DBGET integrated database retrieval system