Arabidopsis thaliana (thale cress): AT2G44690 Help Entry AT2G44690         CDS       T00041                                  Symbol ARAC9 Name (RefSeq) RAC-like 9   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath04145   Phagosome ath04148   Efferocytosis ath04620   Toll-like receptor signaling pathway ath05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ath00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     AT2G44690 (ARAC9)    04148 Efferocytosis     AT2G44690 (ARAC9)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     AT2G44690 (ARAC9)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     AT2G44690 (ARAC9)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT2G44690 (ARAC9)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ath04147]     AT2G44690 (ARAC9)    04031 GTP-binding proteins [BR:ath04031]     AT2G44690 (ARAC9) Membrane trafficking [BR:ath04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     AT2G44690 (ARAC9)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     AT2G44690 (ARAC9)   Macropinocytosis    Ras GTPases     AT2G44690 (ARAC9)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     AT2G44690 (ARAC9) Exosome [BR:ath04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AT2G44690 (ARAC9)   Exosomal proteins of other body fluids (saliva and urine)    AT2G44690 (ARAC9)   Exosomal proteins of colorectal cancer cells    AT2G44690 (ARAC9)   Exosomal proteins of bladder cancer cells    AT2G44690 (ARAC9) GTP-binding proteins [BR:ath04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     AT2G44690 (ARAC9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Sua5_C GTP_EFTU Motif Other DBs NCBI-GeneID:  819077 NCBI-ProteinID:  NP_566024 TAIR:  AT2G44690 UniProt:  Q9XGU0 A0A384LBU4 Q1ECR0 LinkDB All DBs Position 2:18429121..18430882 Genome browser AA seq 209 aa AA seqDB search MSASMAATSTSSATATTFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFNANVL VDGKTVNLGLWDTAGQEDYNRVRPLSYRGADVFILAFSLISRPSFENIAKKWVPELRHYA PTVPIVLVGTKSDLRDNMQFPKNYPGACTIFPEQGQELRKEIGALAYIECSSKAQMNVKA VFDEAIKVVLHPPSKTKKRKRKIGLCHVL NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgtcagcttcaatggctgcaacatcaacatcatcagcaacagctacaacgtttataaag tgtgtcactgttggcgatggagctgtgggcaaaacttgtcttcttatttcctacaccagc aacacgttccccactgattatgttccaacagtgttcgacaatttcaatgctaatgtttta gtcgatggtaaaactgtcaatctgggtctctgggatactgctggtcaagaagactacaat agggttagaccattgagttacagaggagcagatgttttcattcttgccttctcacttatt agcaggcctagctttgagaacattgctaaaaagtgggtacccgagctgagacattatgcc ccgactgtgcctattgttcttgtgggaaccaaatcagatctaagagacaacatgcagttc ccaaagaattatccaggtgcttgcacaatcttcccagaacagggtcaagaactaagaaag gaaataggagcattagcatacatagagtgcagctcaaaagcacaaatgaacgtaaaagcc gtgtttgatgaagcgatcaaagtagttttacatcctccttcaaagactaagaagcgaaag agaaagatcggtttatgccatgttctttga

DBGET integrated database retrieval system