Arabidopsis thaliana (thale cress): AT2G45170 Help Entry AT2G45170         CDS       T00041                                  Symbol ATG8E Name (RefSeq) AUTOPHAGY 8E   KO K08341   GABA(A) receptor-associated protein Organism ath  Arabidopsis thaliana (thale cress) Pathway ath04136   Autophagy - other Brite KEGG Orthology (KO) [BR:ath00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     AT2G45170 (ATG8E)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT2G45170 (ATG8E)    04121 Ubiquitin system [BR:ath04121]     AT2G45170 (ATG8E)    03029 Mitochondrial biogenesis [BR:ath03029]     AT2G45170 (ATG8E) Membrane trafficking [BR:ath04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     AT2G45170 (ATG8E) Ubiquitin system [BR:ath04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    AT2G45170 (ATG8E) Mitochondrial biogenesis [BR:ath03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     AT2G45170 (ATG8E) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  819125 NCBI-ProteinID:  NP_182042 TAIR:  AT2G45170 UniProt:  Q8S926 A0A178VZA0 LinkDB All DBs Position 2:18624264..18625791 Genome browser AA seq 122 aa AA seqDB search MNKGSIFKMDNDFEKRKAEAGRIREKYPDRIPVIVEKAEKSEVPNIDKKKYLVPSDLTVG QFVYVIRKRIKLSAEKAIFIFVDNVLPPTGELMSSVYEDKKDEDGFLYITYSGENTFGAS SI NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaataaaggaagcatctttaagatggacaacgatttcgaaaagagaaaagctgaagct ggaaggatcagggagaaataccctgatcgaattcctgtgattgtggaaaaggctgagaaa agtgaagtcccaaatatagacaagaagaagtaccttgtgccatcagacctaacagttggt caatttgtgtatgtgattcggaagagaatcaaactaagtgcagagaaagctatcttcatt ttcgtagacaatgttcttcctccaacaggagagctaatgtcaagcgtttacgaggataag aaagacgaagatggcttcctttacatcacttacagtggcgagaacacattcggtgcttct tcaatctaa

DBGET integrated database retrieval system