KEGG   Arabidopsis thaliana (thale cress): AT2G45690
Entry
AT2G45690         CDS       T00041                                 
Symbol
SSE1
Name
(RefSeq) shrunken seed protein (SSE1)
  KO
K13335  peroxin-16
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G45690 (SSE1)
SSDB
Motif
Pfam: Pex16
Other DBs
NCBI-GeneID: 819177
NCBI-ProteinID: NP_566053
TAIR: AT2G45690
UniProt: Q8S8S1
LinkDB
Position
2:complement(18823167..18825763)
AA seq 367 aa
MEAYKQWVWRNREYVQSFGSFANGLTWLLPEKFSASEIGPEAVTAFLGIFSTINEHIIEN
APTPRGHVGSSGNDPSLSYPLLIAILKDLETVVEVAAEHFYGDKKWNYIILTEAMKAVIR
LALFRNSGYKMLLQGGETPNEEKDSNQSESQNRAGNSGRNLGPHGLGNQNHHNPWNLEGR
AMSALSSFGQNARTTTSSTPGWSRRIQHQQAVIEPPMIKERRRTMSELLTEKGVNGALFA
IGEVLYITRPLIYVLFIRKYGVRSWIPWAISLSVDTLGMGLLANSKWWGEKSKQVHFSGP
EKDELRRRKLIWALYLMRDPFFTKYTRQKLESSQKKLELIPLIGFLTEKIVELLEGAQSR
YTYISGS
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggaagcttataagcaatgggtttggagaaatagagagtatgtacaatcctttggatcc
tttgccaacggattgacatggctgcttcctgagaagttttctgcttcagagattggacca
gaagcagtaacggcttttttgggcatattctcaacgataaatgaacacataattgaaaat
gctccaacacctcgtggccatgttggatcttccgggaatgatccatccctttcttatcca
ctactcatcgccatcctcaaggatttggaaactgttgtggaagtggcagctgaacacttc
tatggagacaaaaaatggaactacattattctcactgaagctatgaaggctgtcattagg
ttagccttgttccggaatagtgggtataagatgcttcttcaaggaggggaaacacctaat
gaggagaaagattctaaccaatccgagtcgcaaaatagagctggtaattcgggtagaaat
ctcgggcctcatggtcttggaaaccaaaatcatcataatccatggaacttggaaggacgg
gcgatgtctgctttaagttcatttggtcagaatgcaagaacaacaacatcttctaccccc
ggttggtctcgaagaattcaacatcagcaagcagttatagagcctccaatgatcaaggag
aggcgaagaacgatgtccgagctacttactgagaagggtgttaatggagcgttgtttgcg
attggtgaggttctttacataacgagaccgctcatttacgttcttttcatcagaaaatat
ggagtccgatcttggattccttgggctatatcgctttctgtggacacactggggatgggt
cttcttgcaaattcgaagtggtggggagagaagagcaagcaagtccatttctcaggacct
gaaaaggatgagctgaggagacgaaaactgatatgggcattgtacctcatgagagatcca
ttcttcaccaagtacacaaggcagaagctggaaagctctcaaaagaagctggaactaatt
ccattgatcggattcctcacagagaaaattgtggagcttttggagggagctcagtcacgg
tacacttacatatcgggatcgtga

DBGET integrated database retrieval system