Arabidopsis thaliana (thale cress): AT2G45695 Help Entry AT2G45695         CDS       T00041                                  Name (RefSeq) Ubiquitin related modifier 1   KO K12161   ubiquitin related modifier 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     AT2G45695  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:ath03016]     AT2G45695    04121 Ubiquitin system [BR:ath04121]     AT2G45695 Transfer RNA biogenesis [BR:ath03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     AT2G45695 Ubiquitin system [BR:ath04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    AT2G45695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 ThiS DUF1953 Motif Other DBs NCBI-GeneID:  5007965 NCBI-ProteinID:  NP_001078064 TAIR:  AT2G45695 UniProt:  A0MDQ1 A0A178VS32 LinkDB All DBs Position 2:18825954..18826899 Genome browser AA seq 101 aa AA seqDB search MQLTLEFGGGLELLCDSEKIHKVNVDLPNGADSDDFTMKHLLSWVRTNLIKERPEMFMKG DTVRPGVLVLVNDCDWELSGQLDTVIEDKDVVVFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgcaattaactcttgaattcgggggtgggttagagctgctctgtgattctgaaaagatt cataaagtaaacgttgatttgcccaatggagctgactctgatgattttaccatgaagcat ttgctttcatgggttcgtacaaatctgatcaaagagagacctgagatgttcatgaaagga gatactgtgagacctggggttcttgtgctggtgaatgactgtgattgggagctaagtggt cagctcgatacagtaatcgaagataaagatgttgtagttttcatttccactttgcatggt ggataa

DBGET integrated database retrieval system