KEGG   Arabidopsis thaliana (thale cress): AT2G46340
Entry
AT2G46340         CDS       T00041                                 
Symbol
SPA1
Name
(RefSeq) SPA (suppressor of phyA-105) protein family
  KO
K16240  protein suppressor of PHYA-105 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G46340 (SPA1)
SSDB
Motif
Pfam: WD40 Pkinase PK_Tyr_Ser-Thr WD40_like
Other DBs
NCBI-GeneID: 819242
NCBI-ProteinID: NP_001325255
TAIR: AT2G46340
UniProt: Q9SYX2 A0A178VSM9
LinkDB
Position
2:complement(19022154..19027528)
AA seq 1029 aa
MPVMERVAEETVATNNIQLKARVDDVPCNKLDARHNDMVIQSETANSDCPGSSAHRNVDL
TKPPPPEEAAGAKLSVEELTLGNYRIVQGSNNTNVDSPRAGKFEHLYRLARGSAFRAGDG
DLDSQPRDMDQMLSRIRQQLAGAPSERQNLKPFMSRRSDQNLEAFSERLRAAGENSIMNA
PALISEGVQMKTPVSSSNFSQLLLKRAMKGKGVVGKNQETPPEFVSDQDLGSKEKKLDIS
KSPTPHDVLPLKSSPKGNGMVSHGDGNHSKSSIGISLREFLRSSYAKREKRHGLCLFRQL
VELVDSAHSKRLFLLDLRPSLFTLVPSKKLRYIGNFGKNDLESDVDEDLNRRRPVVEESS
SGGRDSKKRKMDLHLNSPGNQLQATSTGRPFKRKSPVIDLNMVDARNPDSCELQQQDYIK
NLSVSSVSRKQSMSTWLEEQWYTCPEEINGEDIGEKSNIYALGVLLFELLCHCESGEMHA
AMMADLRHRILPPTFLSKYPKEAGFCLWLLHPEPSSRPSARDILKSELICEDDSVKSTAA
AEEISELLLHFLSSLEVQKKKKASKLLQDIQTLEDDIKEAERRYSSNVSLVRSHGAIEKR
VQSSPLDEHCTTSSALFVPTANTDRLMSNIRQLEDAYFFMRSQINLSSSAATARSDKTLK
DRDRCSENQNENQDMSTKGKSSDQLEVFFEGLCKFARYSKFETCGTIRSGDLLNSASVVC
SLSFDPDEEHIAAAGISKKIKIFDFNAFMNESVGVHYPLVEMVNKSKLSCVCWNSYIKNY
LASTDYDGVVQIWDAGTGQGFSQYTEHQKRAWSVDFSPSDPTKFVSGSDDCSVKLWSINE
KRSLGTIWSPANVCCVQFSSYSNHLLAFGSADYKVYCYDLRYVKTPWCTLAGHEKAVSYV
KFMDSETIVSASTDNSLKLWNLNKTNSSGLSPGACSLTYKGHTNQKNFVGLSVLDGYIAC
GSETNEVYSYYKSLPMPMTSYKFGSVDPISGNEYFDDNGQFVSSVCWRKKSNMLVAANST
GNMKLLKLV
NT seq 3090 nt   +upstreamnt  +downstreamnt
atgcctgttatggaaagagtagctgaagaaactgtggcgactaacaacatacaattgaaa
gcacgagtggatgatgttccttgtaataagcttgatgctcgtcataacgatatggtgatt
caatcagaaactgcaaacagtgattgtcctggaagctcagctcacaggaatgttgatttg
actaagccgccgcctcctgaggaagccgcaggagctaagctttctgttgaagagttgaca
ttggggaactacaggattgttcaagggagtaataatactaatgtggatagtcctagggct
ggcaagtttgagcatctttatcgtttggctagagggtctgcttttagggcaggagatggg
gatcttgattctcaacctcgtgatatggatcaaatgttgtccagaatcagacaacagctt
gctggagctccttctgagaggcaaaacttgaaaccttttatgtctaggaggagcgatcag
aatcttgaagctttttctgaacgtctaagagcagctggtgagaatagtattatgaatgct
cctgcattgatcagtgaaggtgtccaaatgaaaacgccggtgagttcttcgaatttttct
cagttgttacttaaaagagctatgaaagggaaaggggtagtaggaaagaaccaggaaact
cctcctgaatttgtctctgatcaagatttaggaagcaaggaaaaaaagttggatattagc
aagtcgcctactcctcacgatgtgttacctctaaaatcaagtcccaaaggaaatggtatg
gtatcacatggtgatgggaatcatagtaaatcttctattggaatcagtttgagggagttt
cttagatcaagttatgctaaaagagaaaaaagacatggcctttgtctatttaggcagctg
gtggaactggttgactcagcccattcaaaaagattattcttgctagacttgagaccatcc
cttttcactttagttccatcaaagaaacttagatatattggtaattttggaaagaacgat
ctagaatcagatgttgacgaagatttgaataggaggaggcctgttgttgaggaatcatct
agtggaggtagggattcgaagaaaagaaaaatggacttgcatttgaattctccagggaat
caacttcaggccacttcaaccgggcgacctttcaaaaggaaaagccctgtgattgattta
aacatggttgatgcacgtaatccagacagttgcgagcttcaacagcaagactacataaaa
aatttaagcgtgtcttcagtgtcgagaaaacagtctatgtccacatggctagaagagcaa
tggtatacttgtccagaggagataaatggagaagatattggagaaaaatcaaatatttat
gcccttggtgttcttctgtttgagttgctatgccattgcgagtcaggcgagatgcatgct
gcaatgatggcagatttacgccatcggattctcccaccaacatttctctcgaaatacccg
aaggaagctggattttgtctttggcttctacatcctgaaccctcctcccgaccatcagct
agagatatactaaagtcagagttgatatgcgaggatgattcagttaaatcgactgctgct
gctgaggagatatctgagctgttacttcattttttgtcttcattagaagtgcagaagaag
aaaaaagcatctaaacttttgcaagatatccagaccttagaggatgatattaaggaggcc
gagcgaagatattcttcaaatgtatctctggtgagatctcatggagctattgaaaaaagg
gtgcaatcatctcccctagacgagcactgtacaacttccagtgccttgtttgtaccaact
gctaatacagacaggctgatgagtaatatccgtcaacttgaagatgcatattttttcatg
cgatcacaaatcaacttatcgagttctgctgctactgcccgttctgacaaaacactaaag
gacagggacagatgctctgaaaaccaaaatgaaaatcaggatatgagtaccaaaggaaaa
tcttcagatcaactcgaagtgtttttcgaggggttgtgcaaatttgctcggtatagcaag
ttcgaaacctgtgggacaataagaagtggggaccttttaaactctgcaagtgtggtctgc
tcgttgagttttgaccctgatgaagaacacatagcagcagctgggatatcaaagaagatc
aagatttttgacttcaatgcatttatgaatgaatctgtcggtgttcattatccactagta
gagatggtcaacaaatctaaattaagctgtgtttgctggaatagctacatcaaaaactac
ttggcctcgactgactacgatggtgtagttcagatatgggatgccggcactggacaagga
ttttcgcagtacacagaacaccagaagagagcctggtcagttgatttttctccatctgac
ccgacaaaatttgttagtggaagtgatgactgctcggtgaagctttggagcatcaatgag
aaacgttcattaggcacaatctggagtccagcaaatgtgtgttgcgtgcaattctcttct
tattccaatcacttattggcatttgggtcagctgattacaaggtctattgctatgacctt
cggtatgtcaaaacaccttggtgcacattggctggtcatgagaaagcggtgagttatgtt
aaatttatggattcagaaaccattgtttctgcttccactgataactctctcaagctttgg
aatcttaacaagacaaattcctctggtttatctcctggtgcttgttcattgacatataaa
ggacatacaaatcagaagaatttcgttggattgtcggttttggacggatacatagcttgt
ggttcagagaccaatgaggtatatagttactataaatctttaccgatgccaatgacttca
tacaagtttggatccgtcgatcccatttctggaaacgaatactttgatgacaatggacag
tttgtgtcgagcgtctgttggaggaaaaaatcgaatatgcttgtagctgcaaactctact
ggaaacatgaagctactaaaacttgtttga

KEGG   Arabidopsis thaliana (thale cress): AT4G11110
Entry
AT4G11110         CDS       T00041                                 
Symbol
SPA2
Name
(RefSeq) SPA1-related 2
  KO
K16240  protein suppressor of PHYA-105 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT4G11110 (SPA2)
SSDB
Motif
Pfam: WD40 Pkinase ANAPC4_WD40 WD40_like PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 826712
NCBI-ProteinID: NP_192849
TAIR: AT4G11110
UniProt: Q9T014
LinkDB
Position
4:6771605..6777225
AA seq 1036 aa
MMDEGSVGDVSRIDEADVAHLQFKNSEQSFKPENIEVREVKEVQVQREAGSPDCSYGVIA
DFLDGKNGGDHVELIGNEPCSSRQNTNDEGDVVEELTVKTCEGSSMAIVGRPSSRARLEM
NRSQFLHRFPLDGDLPGSSSMSKKVIDRGTVSILRNAGKMSLPETSNGQLAIIAVNGEAN
EHLTNVERNPVPVEALSHEGIKTKMLSQSGFSQFFVRKTLKGKGVTFRGPPNNRSKARNM
DQQTVASSGSALVIANTSAKISSSIPLAAYDGLPCLPSNTSKPSSCANPSDTHRGCGGEG
LSLREWLKSERQEVNKAECMYIFRQIVDHVDCSHSQGVVLCDLRPSSFKIFKENAVKYVV
SGSQRESFDSNMNKETLSQLENPLVRRRLGDTSSLSIPAKKQKSSGPSSRQWPMFQRAGG
VNIQTENNDGAIQEFHFRSSQPHCSTVACPFTSVSEQLEEKWYASPEELRGDMRSASSNI
YSLGILLYELLSQFQCERAREAAMSDIRHRILPPKFLSENPKEAGFCLWLLHPESSCRPS
TRDILQSEVVNGIPDLYAEGLSLSIEQEDTESELLQHFLFLSQEKRQKHAGNLMEEIASV
EADIEEIVKRRCAIGPPSLEEASSSSPASSVPEMRLIRNINQLESAYFAARIDAHLPEAR
YRLRPDRDLLRNSDNTVAEVENSETWSSDDRVGAFFDGLCKYARYSKFETRGVLRTSELN
NTSNVICSLGFDRDEDYFATAGVSKKIKIYEFNSLFNESVDIHYPAIEMPNRSKLSGVCW
NNYIRNYLASSDYDGIVKLWDVTTGQAISHFIEHEKRAWSVDFSEACPTKLASGSDDCSV
KLWNINERNCLGTIRNIANVCCVQFSPQSSHLLAFGSSDFRTYCYDLRNLRTPWCILSGH
NKAVSYAKFLDNETLVTASTDNTLKLWDLKKTTHGGLSTNACSLTFGGHTNEKNFVGLST
SDGYIACGSETNEVYAYHRSLPMPITSYKFGSIDPISGKEIEEDNNLFVSSVCWRKRSNM
VVSASSNGSIKVLQLV
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgatggatgagggatcagtaggggatgtgagtaggattgatgaagctgatgttgctcac
cttcaattcaagaatagtgagcagtcgtttaaaccggagaacattgaagtccgggaagta
aaagaagtgcaggttcagagagaagctggttctcctgattgttcttatggtgtaatagca
gattttttagatggtaagaatggtggtgaccatgtggagcttatagggaatgaaccatgt
tctagccggcagaatacaaatgatgagggggatgttgtcgaggagttgactgttaaaact
tgtgagggatcgagtatggctatagttggtagaccaagtagtagagctagattagagatg
aatcgcagtcagtttctgcatcgttttccgctagacggtgatttaccgggtagtagttct
atgagtaagaaggtaattgacaggggaacagtaagtatcttgagaaatgctgggaaaatg
tctttgcctgagacttcaaatggacaactggctattattgctgttaatggagaagctaat
gaacatttgacaaatgttgaacgaaatcctgtacctgtagaggcattgtctcatgaaggc
atcaagacaaagatgttatcgcagtctgggttttctcagttttttgttagaaaaacattg
aaagggaagggagttactttcagaggcccgccaaacaatagatctaaagcgaggaatatg
gatcagcaaactgtagctagttctggtagcgctttagtaatagctaatacttcagcaaag
atttctagcagcatccctttggcggcttatgatggtttgccgtgcttaccttccaatacc
agtaaaccatcttcttgtgctaatccttcagatacacatagaggttgtggaggtgaaggt
ttaagtctgagagaatggttgaagtcggagcggcaggaagttaataaagcagaatgtatg
tatatctttaggcagatcgtggatcatgtggactgttctcattctcaaggagttgtttta
tgtgacctgcgaccatcttcattcaaaattttcaaggaaaatgcagtaaagtatgtggtt
tcaggttctcaacgagagtcttttgacagcaacatgaacaaagagactttaagtcaactc
gaaaaccctctggttagaagacggttaggagatacttctagtctctctatccctgcaaag
aagcagaaatcaagtggaccaagctctagacagtggcctatgtttcaacgagctggtggc
gtcaatatccaaactgaaaataatgatggcgcgatacaggagtttcatttcagatctagt
caacctcattgtagtacagttgcctgcccttttacttcagtgagtgagcagttggaagag
aaatggtatgcgagccctgaggagctcaggggtgacatgcgttcagcctcttcaaacatc
tatagtttgggtattcttctttatgagttgctgagccaatttcagtgtgaaagagctcgt
gaggctgcaatgtctgatatccgacaccgcattcttcctcccaaatttctgtcggagaat
ccaaaggaagctgggttttgtctttggttacttcatccagaatcttcatgccgaccatca
accagggacatcttacaatctgaagtagttaatggaatcccggatttgtatgctgaaggc
ttatctttatccattgaacaagaggacacagagtctgaactcttgcagcatttccttttc
ttgtcccaagagaaaaggcagaagcatgctggaaatttgatggaagaaattgcgtccgta
gaagcagatatcgaggaaattgtcaagagacgttgtgccatagggcctccgtccctggaa
gaagcttctagctcatctcctgcttctagtgtacctgaaatgagactgatcaggaacatt
aatcagcttgaaagcgcttatttcgctgcaaggatagacgcacatctccctgaagcacgt
tataggttacgcccagatagagatctgctaagaaatagtgataatactgtagcagaagta
gaaaacagtgagacttggagctcagatgatcgtgttggagcgttctttgatgggttatgc
aaatatgctcgatatagtaagtttgaaactcggggtgtgctgaggaccagtgagttgaac
aacacttcaaatgtgatttgttctctgggttttgatcgggacgaggattattttgccaca
gctggtgtgtcgaaaaaaattaagatatatgagttcaattcccttttcaacgaatctgtt
gacattcattatccagccatagaaatgccaaatagatcaaagcttagcggcgtttgctgg
aacaactacattaggaactacctagcttcctctgattatgatggtattgtcaagttatgg
gatgtgacaacaggacaggccatttcacatttcatagagcatgagaagagggcttggtct
gttgacttctctgaagcttgtccgacaaaattagccagtggaagcgatgattgttctgtg
aagctatggaacatcaatgagaggaactgcttaggaacaatcaggaacattgcaaacgtt
tgttgtgtgcaattttctccacagtcctctcacttgctagcctttggatcatcagacttc
agaacctactgctatgatctaaggaatttaagaactccttggtgcatactgtcaggacac
aacaaagcagttagctatgcgaagttcttggataatgaaactcttgtaacagcatcaact
gataacacgttaaagctttgggatcttaagaaaaccactcacggtggcctctcaacaaat
gcttgcagcttaacttttggcggccatacaaatgagaagaactttgttggtttgtctact
tctgatggatatatagcttgtggctctgagacaaatgaggtttatgcctatcaccggtct
cttcccatgccaattacctcgtacaagtttggttctattgatccaatatcaggtaaggag
atagaggaggacaacaacctgttcgtttcaagcgtttgctggagaaaaagatcgaatatg
gttgtttcagctagctcaaatgggtcaatcaaagttctacagttggtctga

DBGET integrated database retrieval system