KEGG   Arabidopsis thaliana (thale cress): AT3G08850
Entry
AT3G08850         CDS       T00041                                 
Symbol
RAPTOR1
Name
(RefSeq) Regulatory-associated protein of TOR 1
  KO
K07204  regulatory associated protein of mTOR
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G08850 (RAPTOR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G08850 (RAPTOR1)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    AT3G08850 (RAPTOR1)
SSDB
Motif
Pfam: Raptor_N WD40 HEAT HEAT_2 HEAT_EZ
Other DBs
NCBI-GeneID: 820032
NCBI-ProteinID: NP_566335
TAIR: AT3G08850
UniProt: Q93YQ1 A0A178V9S6
Structure
LinkDB
Position
3:complement(2686457..2695400)
AA seq 1344 aa
MALGDLMVSRFSQSSVSLVSNHRYDEDCVSSHDDGDSRRKDSEAKSSSSYGNGTTEGAAT
ATSMAYLPQTIVLCELRHDASEASAPLGTSEIVLVPKWRLKERMKTGCVALVLCLNITVD
PPDVIKISPCARIEAWIDPFSMAPPKALETIGKNLSTQYERWQPRARYKVQLDPTVDEVR
KLCLTCRKYAKTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPISELDSWLKTPSI
YVFDCSAARMILNAFAELHDWGSSGSSGSSRDCILLAACDVHETLPQSVEFPADVFTSCL
TTPIKMALKWFCRRSLLKEIIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLP
HELFQRLFRQDLLVASLFRNFLLAERIMRSANCNPISHPMLPPTHQHHMWDAWDMAAEIC
LSQLPQLVLDPSTEFQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFR
ALVLLGRFLDMGSWAVDLALSVGIFPYVLKLLQTTTNELRQILVFIWTKILALDKSCQID
LVKDGGHTYFIRFLDSSGAFPEQRAMAAFVLAVIVDGHRRGQEACLEANLIGVCLGHLEA
SRPSDPQPEPLFLQWLCLCLGKLWEDFMEAQIMGREANAFEKLAPLLSEPQPEVRAAAVF
ALGTLLDIGFDSNKSVVEDEFDDDEKIRAEDAIIKSLLDVVSDGSPLVRAEVAVALARFA
FGHKQHLKLAAASYWKPQSSSLLTSLPSIAKFHDPGSATIVSLHMSPLTRASTDSQPVAR
ESRISSSPLGSSGLMQGSPLSDDSSLHSDSGMMHDSVSNGAVHQPRLLDNAVYSQCVRAM
FALAKDPSPRIASLGRRVLSIIGIEQVVAKPSKPTGRPGEAATTSHTPLAGLARSSSWFD
MHAGNLPLSFRTPPVSPPRTNYLSGLRRVCSLEFRPHLLGSPDSGLADPLLGASGSERSL
LPLSTIYGWSCGHFSKPLLGGADASQEIAAKREEKEKFALEHIAKCQHSSISKLNNNPIA
NWDTRFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGFDNHDFPDKGISKLCL
INELDDSLLLVASCDGSVRIWKNYATKGKQKLVTGFSSIQGHKPGARDLNAVVDWQQQSG
YLYASGETSTVTLWDLEKEQLVRSVPSESECGVTALSASQVHGGQLAAGFADGSLRLYDV
RSPEPLVCATRPHQKVERVVGLSFQPGLDPAKVVSASQAGDIQFLDLRTTRDTYLTIDAH
RGSLTALAVHRHAPIIASGSAKQLIKVFSLQGEQLGIIRYYPSFMAQKIGSVSCLTFHPY
QVLLAAGAADSFVSIYTHDNSQAR
NT seq 4035 nt   +upstreamnt  +downstreamnt
atggcattaggagacttaatggtgtctcggttctcgcaatcttctgtttctttggtctcc
aatcaccgttacgacgaagactgtgtctctagtcacgatgacggtgattcccggaggaag
gattctgaggctaagagcagtagtagctacgggaatggtacaacggagggagccgccacc
gccaccagcatggcttacttgcctcagactattgtgctctgcgagcttagacacgacgca
tccgaggcttctgctcccttggggacttctgagatcgtattggtccccaaatggcggctt
aaagaacgaatgaaaacaggatgtgtagctttagttctgtgtttaaacattactgttgat
ccgccggatgttataaagatatctccttgtgctagaatcgaggcatggatagatccattt
tctatggcaccgcctaaagctctcgagacaattggaaaaaatttgagcactcagtatgag
agatggcaacccagggcccgctataaggttcagcttgatccgacagtagatgaggtgagg
aagctgtgcttgacttgtcggaaatatgcaaagaccgagagagttctattccattataat
gggcatggtgtgccaaaacctacagctaatggtgaaatttgggtatttaacaagagttat
acacagtacattcccttgccaatcagtgaacttgattcctggttgaagacaccctccatc
tatgttttcgactgctctgctgctaggatgattctgaatgcctttgctgagcttcatgat
tggggttcttctggttcctctggatcctcaagggactgcattctacttgctgcttgtgat
gtacatgagacacttcctcagagcgttgagtttccagctgatgtttttacgtcttgcctg
acaacgcccattaaaatggcgttgaaatggttctgcaggcgttcgcttctgaaagaaatt
atcgatgaatcacttatcgacaggattccaggccggcaaaacgatcgtaagacattgtta
ggggagttgaactggattttcacagcagtgacggatacaattgcttggaatgtgcttcct
catgaacttttccagagattattcagacaggacttgttggtcgctagccttttccggaat
ttcttacttgctgagagaataatgcggtccgcaaactgtaatccaatatctcaccctatg
ctgcctcctacgcatcaacatcatatgtgggatgcatgggacatggctgctgaaatctgt
ctttctcagcttccccaacttgttctggacccaagcacagagttccagccaagtccgttt
tttactgagcaactgacagcttttgaggtgtggcttgatcatggatctgagcataagaag
ccaccggagcagttacctattgttcttcaggtgttacttagccagtgccatcggtttcgt
gctcttgtacttcttggaagatttcttgatatgggttcatgggctgtggatctggccttg
tctgttggaatattcccatatgtgctgaagcttctgcaaacaacaacgaatgagctaaga
cagatcctggttttcatatggacaaaaattcttgcacttgacaagtcatgtcaaattgat
cttgtgaaggatggggggcatacatacttcatacgatttctagatagctcgggtgcattt
ccagaacaacgagctatggctgcttttgttctggctgtcattgtggatggacatcgacga
ggccaggaagcatgtcttgaagctaatttaattggtgtttgtctcgggcaccttgaagca
tccagaccaagtgatccacaaccagaaccattgtttctacaatggctttgtctttgtctt
ggaaagttatgggaagattttatggaggcccaaataatgggcagggaggcaaatgctttt
gaaaagttggcacctctgctttccgagccccaacctgaggtaagggctgctgcagttttt
gccctgggtaccttgcttgatattgggtttgactctaataaaagtgtggtggaggatgaa
tttgatgatgatgaaaagattagagccgaagacgctatcattaaaagtctcttagatgta
gtttcagatgggagtccacttgtccgagcagaggttgccgtagctcttgcacgttttgcc
tttggccacaaacagcaccttaagttagccgcagcttcatattggaagcctcagtcaagt
tctttgcttacttctctaccttcaatagctaaattccatgatcctgggagtgcaacaatt
gtttctttacacatgagtcctctgactagagctagcacggatagccaaccagtggctcgt
gagtctaggatctcaagcagccctcttggctcctctgggctgatgcaaggatctccatta
tctgatgattcttcgttacattctgattctggaatgatgcatgacagtgtcagcaatgga
gcggtccatcagccaagactgttggataatgctgtttattcgcagtgcgtccgagctatg
tttgcattagctaaagatccatctccacgtattgcaagtctcggacggcgtgtgctttct
attattggaatcgaacaggttgttgcgaaaccctcgaagcccactggccgaccaggggaa
gctgcaacgacatctcacactccacttgctggcctagctcgttcatcctcatggtttgat
atgcatgcaggtaatctgcctttaagttttaggactcccccggtcagcccccctagaaca
aactacctgagtggattgaggagagtttgttcattagagttcaggcctcatctattgggt
tcacccgactcaggattggctgatccgcttttaggcgccagtggatctgaacggagtttg
cttccactatcaactatctacggctggagttgtgggcacttttctaagccacttcttggt
ggtgcggatgctagtcaagagattgcagccaaaagagaagagaaagaaaaattcgcactt
gagcatattgcaaaatgccagcactcttctattagcaagctcaacaataatcctattgcc
aactgggatacaaggtttgaaacgggaacaaagacagccctccttcacccattctctcct
attgtagttgctgcagacgagaatgaacggatcagagtgtggaactatgaggaagcaact
cttctcaatggctttgacaatcatgattttcctgacaaaggaatttcaaagctctgcctc
atcaatgaacttgacgactctctgctacttgttgcatcatgcgatgggtcggtccggata
tggaaaaactatgcaactaagggtaaacaaaagcttgttactgggttttcttcaatccag
ggtcacaagcccggtgcccgtgacttgaacgctgtcgtggactggcaacaacagtccggt
tacctgtatgcttctggggagacgtcaacagtcacactttgggacctggagaaagaacag
cttgtcagatctgttccctctgaatcagaatgtggagttacagcactttctgcttctcaa
gtgcacggaggccaactcgctgctggttttgctgatggatctttgagactctatgatgtt
cggtcacctgaaccgcttgtctgcgcgactcggcctcatcagaaagttgaaagggtggtt
ggcctcagttttcaacctggacttgaccccgcaaaggtggtgagtgcatcacaggcgggt
gacatacagtttcttgaccttagaacaacaagggacacatacctgacgattgatgcacac
aggggttcactcacggccttagctgttcacagacacgctccaataatcgcgagtggatct
gcaaaacagctcattaaagtattcagtcttcaaggggaacaactagggataatccgctac
tacccatccttcatggctcaaaagattggatcagtgagttgcctcacatttcatccgtac
caggttctgctagcagctggagctgctgactcatttgtctccatatacacccacgacaac
tcgcaagcaagatga

KEGG   Arabidopsis thaliana (thale cress): AT5G01770
Entry
AT5G01770         CDS       T00041                                 
Symbol
RAPTOR2
Name
(RefSeq) regulatory-associated protein of TOR 2 (RAPTOR2)
  KO
K07204  regulatory associated protein of mTOR
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT5G01770 (RAPTOR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G01770 (RAPTOR2)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    AT5G01770 (RAPTOR2)
SSDB
Motif
Pfam: Raptor_N HEAT_2 ANAPC4_WD40 Peptidase_C14 HEAT_EZ
Other DBs
NCBI-GeneID: 831681
NCBI-ProteinID: NP_195797
TAIR: AT5G01770
UniProt: Q9LZW9
LinkDB
Position
5:complement(293675..302015)
AA seq 1336 aa
MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIASPRVASSSYENLSAAT
SMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMCLHITVDPPDVIKISPC
ARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVELDPTKDDVRKLCLSCRKY
AKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSELDSWLKTPTIYVFDCSAAR
VILNAFAEGESSGPPKDCILLAACDVHETLPQSVEFPADVFTSCLTTPINIALKWFCRRS
LLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLPRELFQRLFRQDLLVA
SLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWDAWDMAAEICLSQLPQFFLDPNTEF
QPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRYRALVLLGRFLDMGPWA
VDLALSVGIYPCVVKLLQTTTIELRQILVFIWTKILALDKSCQVDLVKDRGHIYFIRFLD
SSDAFPEQRAMAAFILAVIVDGYKRGQESCLEANLIAVCLGHLEATQLCDPPPEPLFLQW
LCLCLGKLWEDYLEAQIMGREANASENLIAGHTNLLQVRAAAVFALGTLLDVGFDSGKGV
CDEEFDDDENIVEDIIIKSLLDVVSDGSPLVRTEVAVALARFAFGHKQHLKSVADSYWKP
QNSLRTSLPSMAKFHDSGTSIVASSDMGSLTRASPDSQPVAREGRISSSLQEPFSGLMQG
SPLADDSSLHSDVGIIHDGVSNGVVHQPRPLDNAIYSQSVLAMFTLAKDPSPRIASLGRR
VLSVIGIEQIVAKPSKSNGRPGEAASASHTPLAGLVRSSSWFDMHTGHLPLTFRTPPVSP
PQTSYLTGLRRVCSLELRPHLLGSPDSGLADPILGVSGSERSLLPQSTIYNWSCGHFSKP
LLGGADANEEIAAQREEKKKFSLEHIAKCQHSSISGLSNIPIANWDTKFETGTKTALLHP
FSPIVVAADENERIRVWNYEEATLLNGFDNNDFPDKGISNLCLVNELDDSLLLVASCNVP
TLSRASFAIRIWKDYATKGRQKLVTGFSSIQGQKPGASGLNAVVDWQQQSGYLYVSGESL
SIMVWDLDKEQLVKSMPFESGCSVTALSASQVHGSQLAAGFADGSVRLYDVRTPDFLVCA
TRPHQRVEKVVGLSFQPGLDPAKIVSASQAGDIQFLDLRRPKETYLTIDAHRGSLTALGV
HRHAPIIASGSAKQLIKVFSLKGEQLGIIKYHTSFMGQQIGPVSCLAFHPYQMLLAAGAA
GSFVSLYTHHNTQLPR
NT seq 4011 nt   +upstreamnt  +downstreamnt
atggcattaggggacttgatggtctccaggctctctcaatcttccgttactgttgtcacc
aatcacctctacgacgacgacgacaactgcgcctcctccgctcacgatgattcccgtgtg
tccatcatcgcctctcccagagtcgcaagtagcagctatgagaacctctccgccgccaca
agcatggcatacttgcctcagactcttgtgctctgtgaccttagacacgacgacgcatcc
gacatcgtccaacccccaagatggcgccttaaagagcgaatgaaaacaggatgtgttgct
ctagttatgtgtttgcacattactgttgatccccctgatgttattaagatttctccctgc
gcaagactcgaatgctggatagatcctttttctatgtttcccccaagaagagctcttgag
gctattggccaaaacttgagcattcagtacgagagatggctggctcgggctcgatataaa
gtcgaattggatcctacaaaggacgatgtcaggaagctctgcttgtcttgccggaaatat
gcaaagactgagagagttttgtttcactataacgggcatggtgtccctaaacctacacct
aatggtgaaatctgggtttacaataagaattttacgcagtacattcccttgccagtcagc
gagcttgattcctggttgaaaacacccaccatttacgtttttgactgctctgctgctagg
gtgatcctcaatgccttcgccgagggggaatcttctggacccccgaaggactgtattcta
ctggctgcttgtgatgtacatgagacacttcctcagagtgttgaatttccagctgacgtt
tttacttcttgcctcacaacacctattaatatcgcattgaaatggttctgcagacgttct
cttctgaaagaatttatagatgaatcacttattgatagaattcccggtcgccaaaatgac
cgtaaaacattgttaggagagttgaactggatcttcactgcagtcacagacaccattgcc
tggaatgtgcttccacgcgaacttttccagagattattcagacaggacttgttggttgct
agccttttccgaaatttcttactagctgagaggataatgcggtccggaaattgtacccca
atatcacatcctatgctacctcctacgcatcagcatcatatgtgggatgcatgggacatg
gctgctgaaatctgcctttctcagcttcctcaattttttctggacccaaatacggagttt
cagccaagttcatttttcactgagcaactgacagcttttgaggtctggctggatcatgga
tctgagcataagaagccaccagagcagttacctattgttcttcaggtcttacttagccag
tgccatcggtatcgtgctctggtgcttcttggaagatttcttgatatgggtccttgggct
gtcgatttggccttatctgttggaatatatccttgcgtagtgaagctgctgcaaacaaca
actattgagctacggcagattcttgttttcatatggacaaagatcctagcacttgataag
tcctgtcaagttgatcttgtgaaggaccggggccacatatatttcattcgatttttagat
agttctgatgcattcccagaacaacgtgctatggctgcgtttattttggctgttattgtc
gatggctacaaacgaggccaagaatcatgtcttgaagctaatttaattgctgtttgtctg
gggcacctcgaagcaacccaactatgtgatccaccgccagaaccattgtttctacaatgg
ctttgtctttgtcttggaaagttgtgggaggactatttggaggcccagataatgggtagg
gaggcaaatgcttctgagaatctaattgctggccacaccaatctcttgcaggtcagggct
gctgctgtttttgccttgggtaccttacttgatgttgggtttgactctggtaaaggtgtt
tgtgatgaagaatttgatgatgatgaaaatatagttgaagatattatcataaaaagtctc
ttagatgtagtttcagatgggagcccgcttgtccgaacagaggttgctgtagctctcgca
cggtttgcttttggacacaaacaacatctaaagtcagttgcagattcatactggaagccc
caaaattctctgcgaacttctctcccttcaatggccaagtttcatgactctgggacttca
atagttgcttcttcagacatgggttctctgactagagctagccctgatagccaaccagtg
gctcgtgaaggaaggatctcaagcagcctccaagaacctttttccgggctaatgcaagga
tctccattagctgatgactcctccttgcattctgatgttggaatcatccatgatggtgtc
agcaatggagttgtccatcagccaagaccgctggataatgctatctattcgcagagtgtt
ctagctatgtttaccttagctaaagatccatctccacgtattgcaagccttgggcggcgt
gtgctttctgttattgggattgaacaaattgttgcgaaaccctccaagtccaatggccga
ccaggtgaagcagcatcagcatctcacactcctctggctggcctagttcgctcatcctct
tggtttgacatgcatacaggccacctaccgttaacatttaggactcctccggtaagccct
ccgcaaacaagctatttaactggactgaggagagtttgttcgctagagctccgacctcat
ctgctgggttctcccgactctggattggctgatccgattttaggtgtaagcgggtctgaa
cggagtttgcttccacaatcaactatctacaactggagctgtggtcacttttccaaacct
cttcttggcggagcagatgctaatgaagagatagcagcccaaagagaagaaaaaaaaaag
ttttcgctggagcatattgcaaaatgccagcattcatcaataagcgggctcagcaatatt
ccgattgctaattgggatacaaagtttgaaacgggaacaaagacggccctccttcaccct
ttttctcctattgtagttgctgccgatgagaatgaacggattagggtgtggaattacgag
gaagcaactcttcttaatggctttgacaataacgattttcctgacaaaggaatttcaaat
ctctgccttgtcaatgaacttgatgactctctgctacttgttgcctcttgtaatgttcca
actctttccagagcgtcttttgcaatccgtatatggaaagactacgcaacaaagggtaga
caaaaacttgtcacagggttttcgtcaatccaaggtcagaagcctggtgcaagtggcctg
aacgctgtcgtggactggcaacaacagtcaggttacctgtatgtttctggggaatcgtta
tcaatcatggtttgggacctggataaagaacagctcgtcaaatctatgccctttgaatcc
gggtgcagcgtcacagccctttcggcttctcaagtgcatgggagtcaacttgctgctggt
tttgcggatggatctgtaagactctacgacgttcgcacacctgactttcttgtgtgcgcc
actcggcctcatcagcgagtagaaaaagtagttggactcagctttcagcctggactcgat
ccagcaaagattgtgagcgcatcacaagcaggtgacattcagtttctggatctgagaaga
ccaaaggagacatacctgactatagacgcgcatagaggatcactgacagcattgggtgtt
catagacatgctccaatcatagcgagcgggtcagcaaaacagctaataaaagtgttcagc
cttaaaggagagcaacttgggatcataaagtaccacacttccttcatgggccaacagatt
ggcccagtcagttgcctcgcctttcacccttaccagatgttgttagccgcaggggctgct
ggctccttcgtctccttatacacccaccacaacacacaattaccaagatag

DBGET integrated database retrieval system