Arabidopsis thaliana (thale cress): AT3G27100 Help Entry AT3G27100         CDS       T00041                                  Name (RefSeq) transcription/mRNA export factor   KO K11368   enhancer of yellow 2 transcription factor Organism ath  Arabidopsis thaliana (thale cress) Brite KEGG Orthology (KO) [BR:ath00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ath03021]     AT3G27100    03019 Messenger RNA biogenesis [BR:ath03019]     AT3G27100    03036 Chromosome and associated proteins [BR:ath03036]     AT3G27100 Transcription machinery [BR:ath03021]  Eukaryotic type   RNA polymerase II system    Coactivators     SAGA/TFTC/STAGA complex      AT3G27100 Messenger RNA biogenesis [BR:ath03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      AT3G27100 Chromosome and associated proteins [BR:ath03036]  Eukaryotic type   Histone modification proteins    HAT complexes     SAGA complex      AT3G27100     SLIK complex      AT3G27100 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EnY2 Motif Other DBs NCBI-GeneID:  822329 NCBI-ProteinID:  NP_189346 TAIR:  AT3G27100 UniProt:  Q6NQ54 LinkDB All DBs Position 3:complement(9994481..9996115) Genome browser AA seq 115 aa AA seqDB search MKHSVNRPPTPDEDDVADGFEKDKVTLREIINVKLVESGEKENLMELVRDRLVECGWKDE MRIACREHVKKKGRKDVTVDELIRVITPKGRASVPDSVKAELLNRIQNFIVSAAL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaaacattcggtgaatcggcctccgacaccagatgaagacgatgtggcggatggtttc gagaaagacaaggtcacgcttcgagaaatcatcaacgtcaagttggtggagagtggagag aaggagaatctaatggagcttgtgagagatagattggtggagtgtggttggaaagatgag atgagaattgcttgcagggagcatgtaaagaagaaagggagaaaagatgttacagtcgat gaactgatccgagtgatcactcctaaaggcagagcttcagtaccagattctgtgaaggca gagctgttgaacagaattcaaaacttcattgtatcagctgctctttga

DBGET integrated database retrieval system