KEGG   Arabidopsis thaliana (thale cress): AT3G28910
Entry
AT3G28910         CDS       T00041                                 

Gene name
MYB30
Definition
(RefSeq) myb domain protein 30
  KO
K23865  transcription factor MYB30
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT3G28910 (MYB30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT3G28910 (MYB30)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    AT3G28910 (MYB30)
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7 Fibrinogen_aC DUF3371 Dynamin_M N-SET
Other DBs
NCBI-GeneID: 822525
NCBI-ProteinID: NP_189533
MIPS: AT3G28910.1
TAIR: AT3G28910
UniProt: Q9SCU7 A0A654FBL8
LinkDB
Position
3
AA seq 323 aa
MVRPPCCDKGGVKKGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNY
LRPGIKRGNFTEHEEKMIVHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKLNKVN
QDSHQELDRSSLSSSPSSSSANSNSNISRGQWERRLQTDIHLAKKALSEALSPAVAPIIT
STVTTTSSSAESRRSTSSASGFLRTQETSTTYASSTENIAKLLKGWVKNSPKTQNSADQI
ASTEVKEVIKSDDGKECAGAFQSFSEFDHSYQQAGVSPDHETKPDITGCCSNQSQWSLFE
KWLFEDSGGQIGDILLDENTNFF
NT seq 972 nt   +upstreamnt  +downstreamnt
atggtgaggcctccttgttgtgacaaaggaggagtgaagaaagggccatggactcctgaa
gaagatatcattttagtcacttacatccaagaacatggtcctggtaattggagagctgtt
cctaccaatactgggctgcttagatgcagcaagagttgtagacttagatggacaaactat
ttaaggccaggaatcaaaagaggcaatttcacagaacatgaagaaaagatgattgttcat
ctccaagccctcttaggaaatagatgggctgcaattgcgtcatatcttccacaaaggaca
gacaatgacattaagaactattggaacactcatttgaagaagaaactcaacaaagtcaat
caagattctcatcaagaacttgaccgttcctcgctctcatcttcaccatcgtcttcttct
gctaattccaactcaaacatctcaagaggccaatgggaaaggcgacttcaaaccgatatc
cacttggcgaaaaaggctctctctgaggctttatctcctgccgttgcaccaatcattaca
tctacagtgacaacaacgtcttcctctgctgaatcaagacgctctacttcctcagctagc
gggtttcttaggacgcaagaaacatctacaacttatgcctcaagcaccgaaaatatcgcg
aaattgctcaaagggtgggtgaaaaactcgccgaagactcaaaactccgcggatcaaatc
gcttctacagaggtaaaagaagtgatcaagagtgatgatgggaaggagtgtgcaggggca
tttcagtcattttctgagtttgatcactcatatcaacaggctggtgtttcacctgatcat
gagaccaaaccagacataactggatgctgcagtaaccaaagtcaatggtctttgtttgag
aagtggttgtttgaggattctggtggacagattggtgatattctattggatgaaaacact
aatttcttctga

DBGET integrated database retrieval system