KEGG   Arabidopsis thaliana (thale cress): AT4G05530
Entry
AT4G05530         CDS       T00041                                 
Symbol
IBR1
Name
(RefSeq) indole-3-butyric acid response 1
  KO
K11147  dehydrogenase/reductase SDR family member 4 [EC:1.1.-.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath01100  Metabolic pathways
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G05530 (IBR1)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Glyco_hydro_10 SPOR Hydant_A_N
Other DBs
NCBI-GeneID: 825905
NCBI-ProteinID: NP_567300
TAIR: AT4G05530
UniProt: Q9S9W2 A0A654FMF5
LinkDB
Position
4:2816317..2818518
AA seq 254 aa
MEKKLPRRLEGKVAIVTASTQGIGFGITERFGLEGASVVVSSRKQANVDEAVAKLKSKGI
DAYGIVCHVSNAQHRRNLVEKTVQKYGKIDIVVCNAAANPSTDPILSSKEAVLDKLWEIN
VKSSILLLQDMAPHLEKGSSVIFITSIAGFSPQGAMAMYGVTKTALLGLTKALAAEMAPD
TRVNAVAPGFVPTHFASFITGSSEVREGIEEKTLLNRLGTTGDMAAAAAFLASDDSSYIT
GETLVVAGGMPSRL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggagaagaagctaccgagaagattggaaggcaaagtcgcgattgtgacggcttcgacg
caagggattggtttcggaatcactgagcgtttcggtctcgaaggcgcttccgtcgtcgtc
tcttcccgcaaacaggcaaatgttgatgaggcagtagcaaaactcaaatccaaagggatt
gatgcatatggaatcgtctgtcatgtttccaatgctcaacatcgccgcaatcttgtcgaa
aagacggttcagaaatatgggaagatagatatcgttgtctgtaacgctgctgccaatcca
tctacagacccaatcttgtctagcaaagaagctgttcttgacaagctttgggaaatcaat
gtcaaatcctctatacttctcctgcaggatatggctcctcaccttgagaagggttcttct
gttatcttcataacttctattgctggattttcaccacaaggagctatggctatgtatggt
gtcactaaaactgctcttctcggactaactaaggcgcttgctgctgagatggcccccgat
acacgtgtgaacgcagttgcacccggttttgtgcccacacactttgcttctttcatcacc
ggtagctctgaagtgagggaaggtattgaagagaagactctgcttaacaggttgggaaca
acgggagacatggctgctgcggctgctttcttagcatcagatgattcttcttacatcact
ggagaaactttggttgtcgctggaggaatgccttcaagactctaa

DBGET integrated database retrieval system