Arabidopsis thaliana (thale cress): AT4G09320 Help Entry AT4G09320         CDS       T00041                                  Symbol NDPK1 Name (RefSeq) nucleoside diphosphate kinase   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism ath  Arabidopsis thaliana (thale cress) Pathway ath00230   Purine metabolism ath00240   Pyrimidine metabolism ath01100   Metabolic pathways ath01110   Biosynthesis of secondary metabolites ath01232   Nucleotide metabolism ath01240   Biosynthesis of cofactors ath04016   MAPK signaling pathway - plant Module ath_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP ath_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP ath_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP ath_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP ath_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:ath00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     AT4G09320 (NDPK1)    00240 Pyrimidine metabolism     AT4G09320 (NDPK1)  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     AT4G09320 (NDPK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT4G09320 (NDPK1) Enzymes [BR:ath01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      AT4G09320 (NDPK1) Membrane trafficking [BR:ath04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     AT4G09320 (NDPK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDK Motif Other DBs NCBI-GeneID:  826515 NCBI-ProteinID:  NP_567346 TAIR:  AT4G09320 UniProt:  P39207 A0A178UXQ6 Structure PDBPDBj LinkDB All DBs Position 4:5923484..5924366 Genome browser AA seq 149 aa AA seqDB search MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSG LVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSV ESARKEIALWFPDGPVNWQSSVHPWVYET NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggagcaaacttttattatgatcaagcctgacggcgtccagagaggactcatcggtgaa gtcatctgcaggtttgagaagaagggtttcactttgaaaggtctgaagttgatcagtgta gagagatcttttgctgagaagcactacgaagacttatcttcaaagtctttcttcagtgga ctcgttgactacattgtatccggccctgttgttgctatgatctgggaaggaaagaatgtt gtcttgaccggaagaaagatcattggagctaccaacccagcagcttctgagcctggaact atccgtggggactttgctattgacattggcaggaacgtgatccatggtagtgactctgtc gagagtgcaagaaaggagattgctttgtggttccctgatggacctgtcaactggcagagc agcgttcacccttgggtctatgaaacttga

DBGET integrated database retrieval system