KEGG   Arabidopsis thaliana (thale cress): AT4G23550
Entry
AT4G23550         CDS       T00041                                 

Gene name
WRKY29
Definition
(RefSeq) WRKY family transcription factor
  KO
K13426  WRKY transcription factor 29
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT4G23550 (WRKY29)
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT4G23550 (WRKY29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT4G23550 (WRKY29)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    AT4G23550 (WRKY29)
SSDB
Motif
Pfam: WRKY FLYWCH
Other DBs
NCBI-GeneID: 828455
NCBI-ProteinID: NP_194086
MIPS: AT4G23550.1
TAIR: AT4G23550
UniProt: A0A384LHJ5 A0A178V2E9
LinkDB
Position
4
AA seq 310 aa
MGEVAYMDEGDLEAIVRGYSGSGDAFSGESSGTFSPSFCLPMETSSFYEPEMETSGLDEL
GELYKPFYPFSTQTILTSSVSLPEDSKPFRDDKKQRSHGCLLSNGSRADHIRISESKSKK
SKKNQQKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERN
PQNPEKFTITYTNEHNHELPTRRNSLAGSTRAKTSQPKPTLTKKSEKEVVSSPTSNPMIP
SADESSVAVQEMSVAETSTHQAAGAIEGRRLSNGLPSDLMSGSGTFPSFTGDFDELLNSQ
EFFSGYLWNY
NT seq 933 nt   +upstreamnt  +downstreamnt
atgggtgaggtggcttatatggacgaaggagacctagaagcaatagtcagaggctactcc
ggctccggagacgcgttttccggcgaaagttccggtacgttttcaccttcgttttgccta
ccgatggagacgtctagtttctacgaaccggagatggagacaagtggcttagatgagctc
ggtgaactttacaaacccttttaccctttctccacacaaacgatcctcacaagctcggtc
tctctccctgaagattcaaaacctttccgagatgacaagaaacaacgatcacatggttgt
cttttatccaacggatcaagagctgatcatatccgaatttcagaatccaaatcaaagaaa
agcaagaagaatcaacagaagagagttgttgagcaagtgaaagaagagaatctgttgtcg
gacgcatgggcgtggcgtaaatacgggcagaaacccatcaaaggatctccatacccaagg
agttattacagatgcagtagctcaaaagggtgtttggcaagaaaacaagtcgaaagaaat
cctcaaaacccggagaaattcaccataacatacactaatgagcacaatcatgaactacca
acccggagaaactcattagccggttcgactcgagcaaaaacttcccaacccaaaccaacc
ttaaccaaaaaatccgaaaaagaagttgtttcttcccctacaagtaatcctatgatccca
tccgctgatgaatcttctgttgcggttcaagaaatgagcgttgcggaaacgagtacgcac
caagcggctggagcaatcgagggccgccgcttgagtaacggtttaccatcggatttgatg
tccgggagcggaacttttccaagttttaccggtgacttcgatgaactattgaatagccaa
gagttcttcagtgggtatttatggaattactag

DBGET integrated database retrieval system