KEGG   Arabidopsis thaliana (thale cress): AT4G26090
Entry
AT4G26090         CDS       T00041                                 

Gene name
RPS2
Definition
(RefSeq) NB-ARC domain-containing disease resistance protein
  KO
K13459  disease resistance protein RPS2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT4G26090 (RPS2)
SSDB
Motif
Pfam: NB-ARC LRR_8 LRR_4 ATPase_2 AAA_22 NACHT AAA_16 MeaB ABC_tran AAA AAA_14 KAP_NTPase T2SSE NTPase_1 RNA_helicase AAA_23 Bac_DnaA RsgA_GTPase DUF5906 AAA_24
Other DBs
NCBI-GeneID: 828715
NCBI-ProteinID: NP_194339
MIPS: AT4G26090.1
TAIR: AT4G26090
UniProt: Q42484 A0A654FSW4
LinkDB
Position
4
AA seq 909 aa
MDFISSLIVGCAQVLCESMNMAERRGHKTDLRQAITDLETAIGDLKAIRDDLTLRIQQDG
LEGRSCSNRAREWLSAVQVTETKTALLLVRFRRREQRTRMRRRYLSCFGCADYKLCKKVS
AILKSIGELRERSEAIKTDGGSIQVTCREIPIKSVVGNTTMMEQVLEFLSEEEERGIIGV
YGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKET
GENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMG
AEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMA
HRETEEEWIHASEVLTRFPAEMKGMNYVFALLKFSYDNLESDLLRSCFLYCALFPEEHSI
EIEQLVEYWVGEGFLTSSHGVNTIYKGYFLIGDLKAACLLETGDEKTQVKMHNVVRSFAL
WMASEQGTYKELILVEPSMGHTEAPKAENWRQALVISLLDNRIQTLPEKLICPKLTTLML
QQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQEL
GNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFAD
LEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNELLYFNLPSLTNHGRNLR
RLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINIS
HCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLRTRDLPEL
NSILPSRFSFQKVETLVITNCPRVKKLPFQERRTQMNLPTVYCEEKWWKALEKDQPNEEL
CYLPRFVPN
NT seq 2730 nt   +upstreamnt  +downstreamnt
atggatttcatctcatctcttatcgttggctgtgctcaggtgttgtgtgaatctatgaat
atggcggagagaagaggacataagactgatcttagacaagccatcactgatcttgaaaca
gccatcggtgacttgaaggccatacgtgatgacctgactttacggatccaacaagacggt
ctagagggacgaagctgctcaaatcgtgccagagagtggcttagtgcggtgcaagtaacg
gagactaaaacagccctacttttagtgaggtttaggcgtcgggaacagaggacgcgaatg
aggaggagatacctcagttgtttcggttgtgccgactacaaactgtgcaagaaggtttct
gccatattgaagagcattggtgagctgagagaacgctctgaagctatcaaaacagatggc
gggtcaattcaagtaacttgtagagagatacccatcaagtccgttgtcggaaataccacg
atgatggaacaggttttggaatttctcagtgaagaagaagaaagaggaatcattggtgtt
tatggacctggtggggttgggaagacaacgttaatgcagagcattaacaacgagctgatc
acaaaaggacatcagtatgatgtactgatttgggttcaaatgtccagagaattcggcgag
tgtacaattcagcaagccgttggagcacggttgggtttatcttgggacgagaaggagacc
ggcgaaaacagagctttgaagatatacagagctttgagacagaaacgtttcttgttgttg
ctagatgatgtctgggaagagatagacttggagaaaactggagttcctcgacctgacagg
gaaaacaaatgcaaggtgatgttcacgacacggtctatagcattatgcaacaatatgggt
gcggaatacaagttgagagtggagtttctggagaagaaacacgcgtgggagctgttctgt
agtaaggtatggagaaaagatcttttagagtcatcatcaattcgccggctcgcggagatt
atagtgagtaaatgtggaggattgccactagcgttgatcactttaggaggagccatggct
catagagagacagaagaagagtggatccatgctagtgaagttctgactagatttccagca
gagatgaagggtatgaactatgtatttgcccttttgaaattcagctacgacaacctcgag
agtgatctgcttcggtcttgtttcttgtactgcgctttattcccagaagaacattctata
gagatcgagcagcttgttgagtactgggtcggcgaagggtttctcaccagctcccatggc
gttaacaccatttacaagggatattttctcattggggatctgaaagcggcatgtttgttg
gaaaccggagatgagaaaacacaggtgaagatgcataatgtggtcagaagctttgcattg
tggatggcatctgaacaggggacttataaggagctgatcctagttgagcctagcatggga
catactgaagctcctaaagcagaaaactggcgacaagcgttggtgatctcattgttagat
aacagaatccagaccttgcctgaaaaactcatatgcccgaaactgacaacactgatgctc
caacagaacagctctttgaagaagattccaacagggtttttcatgcatatgcctgttctc
agagtcttggacttgtcgttcacaagtatcactgagattccgttgtctatcaagtatttg
gtggagttgtatcatctgtctatgtcaggaacaaagataagtgtattgccacaggagctt
gggaatcttagaaaactgaagcatctggacctacaaagaactcagtttcttcagacgatc
ccacgagatgccatatgttggctgagcaagctcgaggttctgaacttgtactacagttac
gccggttgggaactgcagagctttggagaagatgaagcagaagaactcggattcgctgac
ttggaatacttggaaaacctaaccacactcggtatcactgttctctcattggagacccta
aaaactctcttcgagttcggtgctttgcataaacatatacagcatctccacgttgaagag
tgcaatgaactcctctacttcaatctcccatcactcactaaccatggcaggaacctgaga
agacttagcattaaaagttgccatgacttggagtacctggtcacacccgcagattttgaa
aatgattggcttccgagtctagaggttctgacgttacacagccttcacaacttaaccaga
gtgtggggaaattctgtaagccaagattgtctgcggaatatccgttgcataaacatttca
cactgcaacaagctgaagaatgtctcatgggttcagaaactcccaaagctagaggtgatt
gaactgttcgactgcagagagatagaggaattgataagcgaacacgagagtccatccgtc
gaagatccaacattgttcccaagcctgaagaccttgagaactagggatctgccagaacta
aacagcatcctcccatctcgattttcattccaaaaagttgaaacattagtcatcacaaat
tgccccagagttaagaaactgccgtttcaggagaggaggacccagatgaacttgccaaca
gtttattgtgaggagaaatggtggaaagcactggaaaaagatcaaccaaacgaagagctt
tgttatttaccgcgctttgttccaaattga

DBGET integrated database retrieval system