KEGG   Arabidopsis thaliana (thale cress): AT4G30510
Entry
AT4G30510         CDS       T00041                                 
Symbol
ATG18B
Name
(RefSeq) autophagy 18 B-like protein
  KO
K17908  autophagy-related protein 18
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT4G30510 (ATG18B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G30510 (ATG18B)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT4G30510 (ATG18B)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    AT4G30510 (ATG18B)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT4G30510 (ATG18B)
SSDB
Other DBs
NCBI-GeneID: 829174
NCBI-ProteinID: NP_001320091
TAIR: AT4G30510
UniProt: Q8H1Q8
LinkDB
Position
4:complement(14905097..14907645)
AA seq 366 aa
MANLSSLPSPIYCVSFNQDNSGFAISWKDSFKIFDSTTGRLCYERAAGAFVIVEMLYSSD
LLAIVGAGEQASLSPRRLCLFKTTTGLPLRELNFLTSILAVRMNKKRLVVVLLEKTFVYD
LNTLVMLDTIDTVPNPKGLSAFSPSLEGCYLAVPASTTKGSVLVYNVMDLQSHSEIDAHR
SPLAAIALSSNGMYIATGSEQGTLIRVHLVSEATKSYSFRRGTYPSTIYSLSFGPSTQLP
DILIATSSSGSIHAFSLSLAINQRSKRSTSFLGSVLPDSVSDALDPAHHHVLQNAVSSGI
RSYAVVRKIDKLEGTSSPSHFTSLRATVSVITYNGYFQEYTLSINNKNESLWTLEREFNL
FSITTG
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcgaatctgtcctctcttccttctcctatctattgtgtttctttcaatcaagataac
agtggttttgcgataagttggaaagattccttcaaaatattcgattccactacaggcaga
ctctgctatgaacgagctgctggagcctttgttattgttgagatgttgtatagctcagat
ctacttgcaattgttggagctggtgaacaggcttctctatccccacggcgtctttgtttg
ttcaagaccacaacgggtttacctcttagggaattgaattttttaacttctatactcgct
gttcgtatgaacaagaaaagacttgttgttgtgctgctagagaaaacattcgtttacgac
ttgaatactcttgtcatgcttgatactatcgacaccgtgccaaatccaaaaggtctatct
gcattctctccatctcttgaaggctgctacttagctgttccagctagtacgacgaaagga
tctgttttggtgtataacgtcatggatttgcagtctcatagtgagattgatgcacatcgt
tctccattggctgcgattgcactgtcttcaaatggaatgtacattgctacaggatctgag
caaggaaccttgatccgagtccatcttgtttcagaagcaactaagtcatatagtttcagg
agaggaacatacccatctactatatattcactgtcttttggaccatcgacacagcttcca
gatatattaattgcaactagttcttcaggctccattcatgccttctctttaagtttggcc
ataaaccaaagaagcaaaaggtctactagctttcttggatcggttcttcccgacagtgtg
agtgatgcactagatccagctcatcatcatgtgcttcaaaacgcagtttcttccgggatt
agaagttatgccgtggttaggaagatagacaaacttgaaggaacatcatctccatctcat
tttacatctcttagagcaacggtatcggtgatcacttataacggatatttccaggagtat
acgctaagtatcaataacaagaatgagtctctatggacactggaacgtgaattcaatctc
ttctccataaccaccgggtga

DBGET integrated database retrieval system