KEGG   Arabidopsis thaliana (thale cress): AT4G30790
Entry
AT4G30790         CDS       T00041                                 
Name
(RefSeq) autophagy-like protein
  KO
K08330  autophagy-related protein 11
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT4G30790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G30790
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT4G30790
Membrane trafficking [BR:ath04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Scaffold protein
    AT4G30790
  Mitophagy
   Scaffold proteins
    AT4G30790
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT4G30790
SSDB
Motif
Pfam: ATG17_like ATG11 IKKbetaNEMObind
Other DBs
NCBI-GeneID: 829202
NCBI-ProteinID: NP_194808
TAIR: AT4G30790
UniProt: Q9SUG7 A0A5S9XZK9
LinkDB
Position
4:complement(14992396..14998649)
AA seq 1148 aa
MSGSFTESFADDGKLLLCVAENGHSFEFQCSETTSVESVMRFVESVSGIALSDQLLLSLD
MKLEPQKLLSAFGLPASDREVFVFNKAMLQSNSHPPSPEDVDLQDVADALPPASLHEHHP
LDDASDPALKALPLYERQFRYHFHKGRTIYNCTVVKHENCERLTREQKVQQRAVEVATRN
LEQYYRVIYQNFLEFMKRYKHQHRLHSDLLMNFGRDIEKLRSAKIHPYLQTESRKCLLDF
VKEDNLKKAVENCASSHRQFENKIAQFQQMFVEVKRKVEELFACRASLSMKNLEVTVKDH
ERFIDEEKSIMQSLSKDVNTVKKLVDDCMSSQVSSSLRPHDAVSALGPMYEVHDKNHLPK
MQACYNSISELLDFCKNKKNEMNNFVHGYMQKITYVTYIIKDAKLQFPVFREAMVRQDDL
FADLKLVRGVGPAYRACLAEVVRRKASMKLYMGMAGQLAEKLAMKRETEVRKREEFLKTH
GPFVPRDVLASMGLYDTPTQCDVNVAPYDTSLLNIEISDVDRYAPEFLVGLHSKIASLKS
SLTMSGDSSLSAEPEEIGIDTFDKDNFDDILAASELIEIAGTSKMEVENAKLKADLASAI
SRICSLGPQFEYEVLDESEVENVLKNAADKTAEALQAKDEYEKHLLLMLKEKQMHCDSYE
KRIRELEQRLSDEYLQGQRHNNKDVSGLNLMHEKVSEYKAEASSDVEGNKTHVSGSEPMD
EVSCVSNLTSKQPCKAREGMDENMVDSSQVLSQPLDSSMLESQQNNEKGGKDSEAGEMGV
FLSNSSTAESPQKSLDDNVATGRGLDAKDSGDIILELRNELMEKSNKLSEMESKLNGAME
EVSNLSRELETNQKLLEESQMNCAHLENCLHEAREEAQTHLCAADRRASQYTALRASAVK
MRGLFERFRSSVCAGSGIADFADSLRTLAQALANSVNENEDDGTTEFRKCIRVLADKVSF
LSKHREELLEKCQNLEATSEQTRKDLEEKKELVKTLYTKHQLGKQANKEKISFGRLEVHE
IAAFVLNQAGHYEAINRNCPNYYLSSESEALFTDHLPSRPTYIVGQIVHIERQIVKLPSQ
LSASASPEAGKTHHLCSDQGSRTLASSSISTSTSATTTSNPYGLSSGCEYFIVTIAMLPD
TAIHQQAS
NT seq 3447 nt   +upstreamnt  +downstreamnt
atgagcggaagcttcactgagagtttcgccgatgatggcaagcttcttctttgtgtggct
gagaatggccactcgtttgaatttcaatgcagcgagactacttcagttgaatctgtgatg
cgtttcgttgaatctgtttctggtattgccttatctgatcagcttcttctctcgctagac
atgaagcttgagccacaaaagctgctttctgcttttggacttcctgcaagtgacagggaa
gtgtttgttttcaacaaggctatgctgcaaagtaactctcatccgccatcaccagaagat
gtagatttgcaagacgttgctgatgctttaccaccggcttcattacatgaacatcatccc
ttggatgatgcatcggatccagctttaaaggctttacctttgtatgaaaggcaatttcgt
taccatttccataaaggccgcaccatctacaattgtacggttgtgaagcatgagaactgc
gaaaggttaacgagagagcaaaaggtacagcagcgggctgttgaagttgctactaggaat
ctggaacagtattacagggtgatctatcagaactttcttgaatttatgaagcgttataag
catcaacaccgcctccactctgatttgctgatgaattttggaagggatattgagaaattg
aggtcagccaagattcacccttatcttcaaactgagtcaaggaaatgcttgttggacttt
gtcaaggaagataacctcaaaaaggctgtggagaattgtgcaagctctcacaggcaattt
gagaataagattgcacagttccagcagatgtttgtcgaggtcaagcgcaaggtagaagag
ttgtttgcctgcagggcttctttatcaatgaagaacttagaagtgactgttaaggatcat
gaacgcttcattgatgaggaaaagagcattatgcagtctctcagcaaagatgtcaatacg
gttaagaaacttgtggatgattgtatgtctagccaagtgtcctcatctctgcgtccccat
gatgctgtttcagccctgggtcctatgtacgaagtgcatgacaagaatcaccttcccaaa
atgcaagcttgctataactcaatttcagaattactggatttctgcaagaacaagaagaat
gagatgaacaactttgtacacggttacatgcaaaagataacatacgtcacatatatcatc
aaagatgctaagttacagtttcccgtttttagagaggcaatggttcgccaggatgactta
tttgcagacttgaagttagtccgtggtgttggccccgcttatagggcctgtcttgcagag
gtggtgagaagaaaagcctctatgaagctttacatgggcatggctgggcaattggcagag
aagcttgctatgaagagggaaacagaggtcaggaaacgtgaggagtttcttaaaacccat
ggcccctttgtacctcgtgacgtgttggcttcaatgggtttatacgatactcctactcag
tgtgatgtcaatgttgctccgtatgatactagtttgctcaatattgaaatctcagatgtt
gatcgatatgctcctgagtttctagttgggttacattcgaagattgcatccttaaagagt
tcactgaccatgtctggtgatagctcgctttccgctgagcctgaggagataggtatagac
acttttgacaaagacaattttgatgatatcctagcagcctctgaattaatagagatagct
ggaaccagcaagatggaagttgagaatgcaaaactaaaagctgaccttgcttctgcaatc
tctcggatctgttcattaggcccacaatttgaatatgaggtactggatgaaagtgaagta
gaaaatgtgttgaaaaatgctgcagataaaacagcagaggcattgcaggccaaagatgag
tatgagaaacatcttctacttatgctcaaggaaaaacaaatgcactgtgattcatatgag
aagcgcatccgtgaactggaacaacgtctctctgatgagtatctacagggacagagacat
aataataaggatgtatctggcttaaaccttatgcatgaaaaagttagtgaatacaaagca
gaagcttcaagtgacgtggaaggcaacaaaactcatgtatctggttcagaaccaatggat
gaggtctcttgtgtttcaaatcttactagcaagcagccatgtaaagctcgggaaggtatg
gatgagaatatggtggattcctctcaggtgctcagtcaaccgcttgactcatcgatgctg
gaaagccagcaaaacaacgagaaaggtggaaaagatagtgaggctggggaaatgggtgtg
tttctaagtaacagttcgacagctgagagcccacaaaaatctttggatgataatgtggca
actggcagaggtttagatgccaaagacagtggtgatattatcttggaacttagaaatgag
ctgatggaaaagtccaataaactgagtgaaatggagtccaagctaaatggtgctatggaa
gaggtatccaatttgagcagagagttggaaacgaatcagaagcttctcgaagaatcccag
atgaattgtgcgcatttggagaactgcttacatgaagcaagagaagaagcccagacccat
ctttgtgctgctgatcgtagagcttctcagtatactgcacttcgtgcatcagctgtgaag
atgcgaggtctctttgaaagattccggagctctgtctgtgctggtagtgggattgctgat
tttgctgactccttgcgaactttggctcaagctttagccaactccgttaatgaaaatgaa
gatgatggtactactgagttccggaaatgcatccgagtcctggcagacaaagttagcttc
ctctccaaacaccgggaggaattattggagaagtgccaaaatcttgaagccacaagtgaa
cagacaagaaaggatttggaggaaaagaaagagctggtgaaaacattgtacactaaacac
caacttgggaagcaggcaaataaggaaaagatatcattcggtcgtcttgaagtccatgag
atagcagcatttgtgctaaaccaagcagggcattacgaggcaatcaacaggaactgccca
aattactacttgtcctctgaatctgaggcattgttcacagatcatctcccaagccggcct
acatacattgttggacagattgtccacatagagcgccaaatagtgaaactgccatcacaa
ctttcagcttctgcttctcctgaggcgggtaagacacatcatctctgctcagaccagggc
tcgagaactctggcatcaagttcaatctcaacatcaacttcagcaacaacaacatcaaac
ccttatggtctctcttcaggatgtgaatacttcatagtgacaatagcaatgcttcctgac
actgctattcatcaacaagcttcctga

DBGET integrated database retrieval system