KEGG   Arabidopsis thaliana (thale cress): AT4G31500
Entry
AT4G31500         CDS       T00041                                 
Symbol
CYP83B1
Name
(RefSeq) cytochrome P450, family 83, subfamily B, polypeptide 1
  KO
K11818  aromatic aldoxime N-monooxygenase [EC:1.14.14.45]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00380  Tryptophan metabolism
ath00966  Glucosinolate biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
Module
ath_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AT4G31500 (CYP83B1)
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    AT4G31500 (CYP83B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ath00199]
    AT4G31500 (CYP83B1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.45  aromatic aldoxime N-monooxygenase
     AT4G31500 (CYP83B1)
Cytochrome P450 [BR:ath00199]
 Cytochrome P450, plant type
  CYP83 family
   AT4G31500 (CYP83B1)
SSDB
Motif
Pfam: p450 FANCI_S2 Goodbye Transposase_31
Other DBs
NCBI-GeneID: 829277
NCBI-ProteinID: NP_194878
TAIR: AT4G31500
UniProt: O65782 A0A178USK3
LinkDB
Position
4:complement(15273410..15275404)
AA seq 499 aa
MDLLLIIAGLVAAAAFFFLRSTTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKL
YGPIFTMKIGGRRLAVISSAELAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTA
YYREMRKMCMVNLFSPNRVASFRPVREEECQRMMDKIYKAADQSGTVDLSELLLSFTNCV
VCRQAFGKRYNEYGTEMKRFIDILYETQALLGTLFFSDLFPYFGFLDNLTGLSARLKKAF
KELDTYLQELLDETLDPNRPKQETESFIDLLMQIYKDQPFSIKFTHENVKAMILDIVVPG
TDTAAAVVVWAMTYLIKYPEAMKKAQDEVRSVIGDKGYVSEEDIPNLPYLKAVIKESLRL
EPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMNEHK
GVDFKGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKGIKPEDIKMDVM
TGLAMHKKEHLVLAPTKHI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggatctcttattgattatagccggtttagtagcggctgcagccttctttttcctccgt
agcacgaccaagaaatctctccggttacctccgggaccaaaaggtcttcctattatagga
aaccttcaccagatggagaaattcaacccccaacacttccttttccgtctctccaagcta
tacggcccgattttcacgatgaaaatcggtggccgtcgcctcgcggtgatctcctcggcc
gagctagccaaggagctactcaaaactcaagacctcaacttcaccgctcgtcctctcttg
aaagggcaacaaaccatgtcgtatcaaggccgtgagcttggtttcggacagtacaccgcg
tactaccgtgagatgaggaagatgtgtatggtgaacctcttcagcccgaaccgtgtcgca
agtttcagaccggttagagaagaagagtgtcaacggatgatggacaagatctataaagcc
gctgatcaatcaggcaccgttgatctaagtgagcttctcttgtctttcactaactgtgtc
gtatgtagacaagcttttgggaaacggtacaatgagtacggcacagagatgaagagattc
atagatatcttgtacgagacgcaagcacttttgggcactctgtttttctccgaccttttc
ccttatttcggattccttgacaacctcactggtctcagtgcacgtctcaagaaagctttc
aaggagcttgacacttaccttcaagaacttctagacgagactcttgaccctaaccgccct
aaacaagaaacagagagtttcattgatcttttgatgcagatctacaaagaccaacctttc
tccatcaaattcactcacgaaaatgtcaaggccatgatattggatattgttgtgccggga
actgacacggcggctgcagtggtggtatgggccatgacttaccttattaagtaccctgaa
gcaatgaagaaagctcaagacgaagtgaggagtgtgataggtgacaaaggatatgtctct
gaagaagacatacctaatctcccttacctaaaggcagtcatcaaggagtctcttcggctc
gaaccagtcatccccattcttctacacagagaaactatcgcagacgcaaagataggtggc
tatgatattccggccaagaccatcattcaggtgaacgcatgggcggtttctcgtgacaca
gccgcgtggggagacaaccctaatgagttcattccagagaggttcatgaacgagcacaaa
ggagtggacttcaagggccaagattttgagctcctacctttcgggtcgggccggagaatg
tgcccggccatgcatcttgggattgcaatggtagagatacctttcgctaaccttctctac
aaatttgactggagtctacctaaagggattaaaccagaggatataaagatggacgtcatg
actggactcgctatgcacaagaaagaacacctcgttcttgcaccaacgaaacacatctga

DBGET integrated database retrieval system