Arabidopsis thaliana (thale cress): AT4G31720 Help Entry AT4G31720         CDS       T00041                                  Symbol TAFII15 Name (RefSeq) TBP-associated factor II 15   KO K03134   transcription initiation factor TFIID subunit 10 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath03022   Basal transcription factors Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     AT4G31720 (TAFII15)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ath03021]     AT4G31720 (TAFII15)    03036 Chromosome and associated proteins [BR:ath03036]     AT4G31720 (TAFII15) Transcription machinery [BR:ath03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIID      AT4G31720 (TAFII15)    Coactivators     SAGA/TFTC/STAGA complex      AT4G31720 (TAFII15) Chromosome and associated proteins [BR:ath03036]  Eukaryotic type   Histone modification proteins    HAT complexes     PCAF complex      AT4G31720 (TAFII15)     STAGA complex      AT4G31720 (TAFII15)     TFTC complex      AT4G31720 (TAFII15)     SAGA complex      AT4G31720 (TAFII15)     SLIK complex      AT4G31720 (TAFII15) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TAF10 Bromo_TP VirC2 Motif Other DBs NCBI-GeneID:  829300 NCBI-ProteinID:  NP_001329548 TAIR:  AT4G31720 UniProt:  O04173 A0A178V2H6 LinkDB All DBs Position 4:complement(15353796..15356431) Genome browser AA seq 134 aa AA seqDB search MNHGQQSGEAKHEDDAALTEFLASLMDYTPTIPDDLVEHYLAKSGFQCPDVRLIRLVAVA TQKFVADVASDALQHCKARPAPVVKDKKQQKDKRLVLTMEDLSKALREYGVNVKHPEYFA DSPSTGMDPATRDE NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgaatcacggccaacaatctggtgaggcaaagcatgaagatgatgctgctcttacagag ttccttgcttctctgatggattatactcctactattcctgatgatttagtggagcactac ttggctaagagtggatttcagtgccccgacgtacgattgataaggctagttgctgtggct acacaaaagtttgttgcagatgttgccagtgacgcccttcagcattgcaaggctagacca gcaccagttgtgaaagacaaaaaacagcaaaaggataagcgtttggtattgacaatggaa gatctttcaaaagctttgcgtgagtatggtgtgaacgtgaagcatccagaatattttgct gatagcccttcgactggaatggaccctgcaacaagggacgaatag

DBGET integrated database retrieval system