Arabidopsis thaliana (thale cress): AT4G34470 Help Entry AT4G34470         CDS       T00041                                  Symbol SK12 Name (RefSeq) SKP1-like 12   KO K03094   S-phase kinase-associated protein 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath03083   Polycomb repressive complex ath04120   Ubiquitin mediated proteolysis ath04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AT4G34470 (SK12)    04120 Ubiquitin mediated proteolysis     AT4G34470 (SK12)   09126 Chromosome    03083 Polycomb repressive complex     AT4G34470 (SK12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT4G34470 (SK12)    04121 Ubiquitin system [BR:ath04121]     AT4G34470 (SK12)    03036 Chromosome and associated proteins [BR:ath03036]     AT4G34470 (SK12) Membrane trafficking [BR:ath04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     AT4G34470 (SK12) Ubiquitin system [BR:ath04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      AT4G34470 (SK12)    Cul7 complex      AT4G34470 (SK12) Chromosome and associated proteins [BR:ath03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      AT4G34470 (SK12)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      AT4G34470 (SK12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Peptidase_C30 SPA Motif Other DBs NCBI-GeneID:  829598 NCBI-ProteinID:  NP_567967 TAIR:  AT4G34470 UniProt:  O65674 LinkDB All DBs Position 4:complement(16480008..16480616) Genome browser AA seq 152 aa AA seqDB search MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCK KYHVDEANPISEEDLNKWDEKFMDLEQSTIFELILAANYLNIKSLFDLTCQTVADMIKGK TPEEIRSTFNIENDFTPEEEEAVRKENQWAFE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgaagatgatcgtgttgatgagctccgatggtcagtcgtttgaggtggaagaa gcggtagcaatccaatcgcagaccatagcgcatatggttgaagacgattgcgttgctgat ggaatccctcttgcaaacgtggaaagcaagattcttgtgaaagtgatcgagtactgcaag aaataccacgtcgacgaggctaatcctatctctgaagaggatctcaacaagtgggacgag aagttcatggatctcgaacaatccaccatctttgaactcatccttgctgcgaattacctc aacataaaaagcttgtttgatctcacatgccaaactgttgcggacatgatcaaaggcaag actccagaggagattcgttcaactttcaacattgagaatgattttacacctgaggaagaa gaagctgttcgtaaggagaatcaatgggcttttgaatga

DBGET integrated database retrieval system