Arabidopsis thaliana (thale cress): AT4G35020 Help Entry AT4G35020         CDS       T00041                                  Symbol RAC3 Name (RefSeq) RAC-like 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath04145   Phagosome ath04148   Efferocytosis ath04620   Toll-like receptor signaling pathway ath05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ath00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     AT4G35020 (RAC3)    04148 Efferocytosis     AT4G35020 (RAC3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     AT4G35020 (RAC3)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     AT4G35020 (RAC3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT4G35020 (RAC3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ath04147]     AT4G35020 (RAC3)    04031 GTP-binding proteins [BR:ath04031]     AT4G35020 (RAC3) Membrane trafficking [BR:ath04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     AT4G35020 (RAC3)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     AT4G35020 (RAC3)   Macropinocytosis    Ras GTPases     AT4G35020 (RAC3)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     AT4G35020 (RAC3) Exosome [BR:ath04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AT4G35020 (RAC3)   Exosomal proteins of other body fluids (saliva and urine)    AT4G35020 (RAC3)   Exosomal proteins of colorectal cancer cells    AT4G35020 (RAC3)   Exosomal proteins of bladder cancer cells    AT4G35020 (RAC3) GTP-binding proteins [BR:ath04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     AT4G35020 (RAC3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  829654 NCBI-ProteinID:  NP_195228 TAIR:  AT4G35020 UniProt:  Q38912 A0A384KTR9 Q5PNX9 LinkDB All DBs Position 4:16672192..16674789 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKL DLRDDKQFFAEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVLQP PKNKKKKKRKSQKGCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcaaggtttatcaagtgtgtcactgtcggcgacggtgctgttggaaagact tgtcttctcatctcctacactagcaacactttccccacggattatgtgccaactgtgttc gataatttcagtgccaatgtgattgttgatggcaacactatcaacttgggattgtgggat actgcagggcaagaggactacaatagactaagacctttgagctatcgcggtgcagatgtc ttcttacttgcattctcacttgtcagcaaagctagctatgaaaatgtttctaaaaagtgg gttcctgaactgagacattatgctcctggtgttcccatcatcctcgttggaacaaagctt gatcttcgagatgataagcaattctttgccgagcaccctggtgctgtgcctatctctacc gctcagggtgaagaactaaagaagctgattggggcgcctgcttatatcgaatgcagtgca aaaactcaacagaatgtgaaagcagtgtttgatgcggctatcaaggtcgttctccagcca ccaaaaaacaagaagaagaagaagagaaaatctcagaaaggttgttctatactctga

DBGET integrated database retrieval system