KEGG   Arabidopsis thaliana (thale cress): AT5G13930
Entry
AT5G13930         CDS       T00041                                 

Symbol
TT4
Name
(RefSeq) Chalcone and stilbene synthase family protein
  KO
K00660  chalcone synthase [EC:2.3.1.74]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00941  Flavonoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath04712  Circadian rhythm - plant
Module
ath_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    AT5G13930 (TT4)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G13930 (TT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:ath01008]
    AT5G13930 (TT4)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  chalcone synthase
     AT5G13930 (TT4)
Polyketide biosynthesis proteins [BR:ath01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    AT5G13930 (TT4)
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III_C ACP_syn_III FAE1_CUT1_RppA OpcA_G6PD_assem CinA
Other DBs
NCBI-GeneID: 831241
NCBI-ProteinID: NP_196897
TAIR: AT5G13930
UniProt: P13114 Q460R0 A0A384KNE5
LinkDB
Structure
PDB: 
6DXB 6DXD 6DXE

Position
5:4488476..4490264
AA seq 395 aa
MVMAGASSLDEIRQAQRADGPAGILAIGTANPENHVLQAEYPDYYFRITNSEHMTDLKEK
FKRMCDKSTIRKRHMHLTEEFLKENPHMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIK
EWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRIAK
DLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEK
PIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIVKSLDEAFKPLGISD
WNSLFWIAHPGGPAILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSA
KDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggtgatggctggtgcttcttctttggatgagatcagacaggctcagagagctgatgga
cctgcaggcatcttggctattggcactgctaaccctgagaaccatgtgcttcaggcggag
tatcctgactactacttccgcatcaccaacagtgaacacatgaccgacctcaaggagaag
ttcaagcgcatgtgcgacaagtcgacaattcggaaacgtcacatgcatctgacggaggaa
ttcctcaaggaaaacccacacatgtgtgcttacatggctccttctctggacaccagacag
gacatcgtggtggtcgaagtccctaagctaggcaaagaagcggcagtgaaggccatcaag
gagtggggccagcccaagtcaaagatcactcatgtcgtcttctgcactacctccggcgtc
gacatgcctggtgctgactaccagctcaccaagcttcttggtctccgtccttccgtcaag
cgtctcatgatgtaccagcaaggttgcttcgccggcggtactgtcctccgtatcgctaag
gatctcgccgagaacaatcgtggagcacgtgtcctcgttgtctgctctgagatcacagcc
gttaccttccgtggtccctctgacacccaccttgactccctcgtcggtcaggctcttttc
agtgatggcgccgccgcactcattgtggggtcggaccctgacacatctgtcggagagaaa
cccatctttgagatggtgtctgccgctcagaccatccttccagactctgatggtgccata
gacggacatttgagggaagttggtctcaccttccatctcctcaaggatgttcccggcctc
atctccaagaacattgtgaagagtctagacgaagcgtttaaacctttggggataagtgac
tggaactccctcttctggatagcccaccctggaggtccagcgatcctagaccaggtggag
ataaagctaggactaaaggaagagaagatgagggcgacacgtcacgtgttgagcgagtat
ggaaacatgtcgagcgcgtgcgttctcttcatactagacgagatgaggaggaagtcagct
aaggatggtgtggccacgacaggagaagggttggagtggggtgtcttgtttggtttcgga
ccaggtctcactgttgagacagtcgtcttgcacagcgttcctctctaa

DBGET integrated database retrieval system