KEGG   Arabidopsis thaliana (thale cress): AT5G17290
Entry
AT5G17290         CDS       T00041                                 
Symbol
APG5
Name
(RefSeq) autophagy protein Apg5 family
  KO
K08339  autophagy-related protein 5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT5G17290 (APG5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G17290 (APG5)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT5G17290 (APG5)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    AT5G17290 (APG5)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT5G17290 (APG5)
SSDB
Motif
Pfam: APG5
Other DBs
NCBI-GeneID: 831594
NCBI-ProteinID: NP_197231
TAIR: AT5G17290
UniProt: Q9FFI2
LinkDB
Position
5:complement(5686135..5689947)
AA seq 337 aa
MAKEAVKYVWEGAIPLQIHLHKSDVASHPAPPPALVLAPRIGYLPLLIPLIKPYFKDSLP
PGEDSIWFDYKGFPLKWYIPTGVLFDLLCAEPERPWNLTIHFRGYPCNILIPCEGEDSVK
WNFVNSLKEAQYIINGNCKNVMNMSQSDQEDLWTSVMNGDLDAYTRLSPKLKMGTVEDEF
SRKTSLSSPQSQQVVPETEVAGQVKTARIPVRLYVRSLNKDFENLEDVPEIDTWDDISYL
NRPVEFLKEEGKCFTLRDAIKSLLPEFMGDRAQTSGEERSIDDTEEADGSREMGEIKLVR
IQGIEMKLEIPFSWVVNNLMNPEFYLHISVLVKAPQR
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgaaggaagcggtcaagtatgtatgggaaggagcaattcctctgcagattcatctc
cacaaatccgacgtcgcttctcaccctgctcctcctcctgctcttgtgttagcaccaaga
ataggatatttgcctctgttgattcctcttataaagccttatttcaaggattcacttcct
cctggtgaagattcaatttggtttgattacaaaggatttcctctaaaatggtatatacca
acaggtgttcttttcgatctcctttgtgcagaacccgaaagaccatggaatctcacgata
cactttagaggatatccttgcaacatactgataccatgtgaaggagaagattctgtaaaa
tggaactttgttaattctttgaaagaggcacaatatatcatcaatggaaattgcaagaat
gttatgaacatgtctcagagtgatcaagaggatctatggacctctgtcatgaacggtgat
cttgatgcctatacaagattatcacccaagcttaaaatgggaacagtcgaagatgagttt
tcaaggaaaacaagtttgtcatctccacaatctcaacaagttgtgcctgagacggaggtg
gctggacaagttaagacagcaagaattcctgttcggttgtatgttcgaagtctaaataaa
gatttcgagaatcttgaagatgtaccggagatcgatacctgggatgacatctcgtacctt
aatcgccctgttgagttcctcaaagaagaagggaaatgctttacgttacgtgacgccatt
aaaagtctcctccctgagtttatgggagacagagcgcaaacgagtggtgaagaaagaagc
atagatgatacagaagaagcagatgggtcgagggagatgggtgaaatcaaattggtaagg
atacaagggatagaaatgaagctagagataccgttttcgtgggtggtaaataacttgatg
aacccagaattctatctccatatctctgtccttgtgaaagctcctcaaaggtga

DBGET integrated database retrieval system