KEGG   Arabidopsis thaliana (thale cress): AT5G17380
Entry
AT5G17380         CDS       T00041                                 
Name
(RefSeq) Thiamine pyrophosphate dependent pyruvate decarboxylase family protein
  KO
K12261  2-hydroxyacyl-CoA lyase [EC:4.1.2.63]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G17380
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.63  2-hydroxyacyl-CoA lyase
     AT5G17380
SSDB
Motif
Pfam: TPP_enzyme_M TPP_enzyme_N TPP_enzyme_C CO_dh ZnuA
Other DBs
NCBI-GeneID: 831604
NCBI-ProteinID: NP_197240
TAIR: AT5G17380
UniProt: Q9LF46 A0A5S9Y4Y8
LinkDB
Position
5:complement(5724759..5726912)
AA seq 572 aa
MADKSETTPPSIDGNVLVAKSLSHLGVTHMFGVVGIPVTSLASRAMALGIRFIAFHNEQS
AGYAASAYGYLTGKPGILLTVSGPGCVHGLAGLSNAWVNTWPMVMISGSCDQRDVGRGDF
QELDQIEAVKAFSKLSEKAKDVREIPDCVSRVLDRAVSGRPGGCYLDIPTDVLRQKISES
EADKLVDEVERSRKEEPIRGSLRSEIESAVSLLRKAERPLIVFGKGAAYSRAEDELKKLV
EITGIPFLPTPMGKGLLPDTHEFSATAARSLAIGKCDVALVVGARLNWLLHFGESPKWDK
DVKFILVDVSEEEIELRKPHLGIVGDAKTVIGLLNREIKDDPFCLGKSNSWVESISKKAK
ENGEKMEIQLAKDVVPFNFLTPMRIIRDAILAVEGPSPVVVSEGANTMDVGRSVLVQKEP
RTRLDAGTWGTMGVGLGYCIAAAVASPDRLVVAVEGDSGFGFSAMEVETLVRYNLAVVII
VFNNGGVYGGDRRGPEEISGPHKEDPAPTSFVPNAGYHKLIEAFGGKGYIVETPDELKSA
LAESFAARKPAVVNVIIDPFAGAESGRLQHKN
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggcggataaatcagaaaccactccaccgtcaattgatggcaacgttctcgtggccaag
tcactctctcatctcggcgtaacccacatgttcggcgtcgttggaatccccgtcacgtct
ctagctagccgagctatggctttaggtatacgtttcatcgccttccacaacgaacaatcc
gctggttacgccgcttcagcttacggttacctcacgggtaaaccgggtatccttttaacg
gtttcgggtccgggttgtgttcatgggctcgcgggtctttccaacgcttgggttaataca
tggccgatggtgatgatctctggttcttgtgatcagagagatgttggtcgtggagatttc
caggagcttgatcagatcgaagcggttaaagctttctcgaaattatcagagaaagcgaaa
gatgttcgtgaaatccctgattgtgtttctagggttttggatcgagctgtttcgggtcga
cccggtgggtgttatctggatattccgactgatgtgttgcgtcagaagatatcggaatcg
gaagctgataaattggtggatgaggttgagagatcacggaaggaagaaccgattcgtgga
tctctgagatcggagattgaatcggcggtttcgttgctgaggaaagctgagaggccgttg
attgtgtttggtaaaggagctgcgtattcgagagcagaagatgagctgaagaagcttgtt
gaaattactggaataccctttttaccaactccgatgggtaaaggtttgttaccggacaca
cacgagttctcggcgactgcggcgaggtctcttgctattgggaaatgtgatgtcgcgttg
gtggttggagctaggcttaactggcttcttcatttcggagagtcgcctaaatgggataaa
gatgtaaaatttatattggtggatgtctctgaggaagagattgagctaaggaaacctcat
ttggggattgttggagatgctaaaactgtgattggattgttgaatagagagatcaaagac
gatcctttttgtttagggaagtctaattcatgggtggaatcgatttcgaagaaggcgaaa
gagaatggtgagaagatggagatacagcttgctaaagatgtggttcctttcaatttcttg
actcctatgaggataatcagagacgctattttggctgtggaaggaccgagtcctgttgtg
gtatcggaaggagctaatacaatggatgtaggaagatctgttttggttcagaaagagcca
aggacaaggcttgatgcaggaacttggggaactatgggtgttggtttaggttattgtatt
gctgctgctgttgcttctcctgatcggcttgttgtcgctgttgaaggagactctggtttt
ggcttcagcgccatggaagtcgagacattggttcgatacaatcttgctgtggtgattata
gtcttcaacaatggtggtgtctacggcggtgatcgaaggggacctgaagaaatctccggt
cctcataaagaagatccagcaccaacatcatttgttcctaatgcaggctaccacaagctc
attgaagcctttggaggcaaaggttatattgtggaaacacccgatgagcttaaatccgct
ctcgctgagtcgttcgccgcaagaaaacccgcggtggtaaatgttattattgatcctttt
gctggtgctgagagtgggagattacagcacaagaactaa

DBGET integrated database retrieval system