Arabidopsis thaliana (thale cress): AT5G21274 Help Entry AT5G21274         CDS       T00041                                  Symbol CAM6 Name (RefSeq) calmodulin 6   KO K02183   calmodulin Organism ath  Arabidopsis thaliana (thale cress) Pathway ath04016   MAPK signaling pathway - plant ath04070   Phosphatidylinositol signaling system ath04075   Plant hormone signal transduction ath04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:ath00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     AT5G21274 (CAM6)    04070 Phosphatidylinositol signaling system     AT5G21274 (CAM6)    04075 Plant hormone signal transduction     AT5G21274 (CAM6)  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     AT5G21274 (CAM6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ath01009]     AT5G21274 (CAM6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT5G21274 (CAM6)    03036 Chromosome and associated proteins [BR:ath03036]     AT5G21274 (CAM6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ath04147]     AT5G21274 (CAM6) Protein phosphatases and associated proteins [BR:ath01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      AT5G21274 (CAM6) Membrane trafficking [BR:ath04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     AT5G21274 (CAM6) Chromosome and associated proteins [BR:ath03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      AT5G21274 (CAM6) Exosome [BR:ath04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    AT5G21274 (CAM6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 SAPC2_N EF-hand_11 Dockerin_1 DUF5580_M RNA_pol_Rpb4 EF-hand_EFHB_C EFhand_Ca_insen Caleosin EF-hand_STIM1 MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  832245 NCBI-ProteinID:  NP_850860 TAIR:  AT5G21274 UniProt:  Q03509 A0A178UHI2 LinkDB All DBs Position 5:complement(7214474..7216052) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctcaccgatgaccagatctcagagttcaaggaagcctttagcctcttc gataaggatggtgatggttgtatcaccaccaaggagctcggaaccgtgatgaggtctctg gggcaaaacccaacagaagctgagcttcaagacatgatcaatgaagttgatgcagatggg aacgggaccattgatttcccggagttcctgaacctgatggcaaggaaaatgaaggacact gattcagaggaagagctcaaggaagcttttagggtttttgataaagaccagaatggtttc atatctgcagcagagcttcgacatgtcatgacaaatctcggtgagaagctatccgatgag gaagttgatgagatgatccgagaagcggatgttgatggcgatggtcagattaactatgaa gaattcgtcaaagtcatgatggctaagtga

DBGET integrated database retrieval system