KEGG   Arabidopsis thaliana (thale cress): AT5G27450
Entry
AT5G27450         CDS       T00041                                 
Symbol
MK
Name
(RefSeq) mevalonate kinase
  KO
K00869  mevalonate kinase [EC:2.7.1.36]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00900  Terpenoid backbone biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath04146  Peroxisome
Module
ath_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT5G27450 (MK)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G27450 (MK)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.36  mevalonate kinase
     AT5G27450 (MK)
SSDB
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C GalKase_gal_bdg ANIS5_cation-bd MVD-like_N
Other DBs
NCBI-GeneID: 832804
NCBI-ProteinID: NP_198097
TAIR: AT5G27450
UniProt: P46086 A0A178UNV0
LinkDB
Position
5:9690428..9693289
AA seq 378 aa
MEVKARAPGKIILAGEHAVVHGSTAVAAAIDLYTYVTLRFPLPSAENNDRLTLQLKDISL
EFSWSLARIKEAIPYDSSTLCRSTPASCSEETLKSIAVLVEEQNLPKEKMWLSSGISTFL
WLYTRIIGFNPATVVINSELPYGSGLGSSAALCVALTAALLASSISEKTRGNGWSSLDET
NLELLNKWAFEGEKIIHGKPSGIDNTVSAYGNMIKFCSGEITRLQSNMPLRMLITNTRVG
RNTKALVSGVSQRAVRHPDAMKSVFNAVDSISKELAAIIQSKDETSVTEKEERIKELMEM
NQGLLLSMGVSHSSIEAVILTTVKHKLVSKLTGAGGGGCVLTLLPTGTVVDKVVEELESS
GFQCFTALIGGNGAQICY
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggaagtgaaagctagagctcctgggaagatcatacttgcaggggaacacgctgttgtt
catggatccaccgctgtagctgccgccattgatctctacacttacgttactctccgcttt
cctcttccatcagctgagaacaatgataggcttacacttcagctcaaggacatttccttg
gagttttcatggtccttagccagaatcaaagaagcgattccttatgattcaagcactctc
tgccgttctacgccggcttcatgttcagaggagacccttaaatcaattgcagttttggtt
gaagagcaaaatcttccaaaggaaaagatgtggctctcctctgggatctccacgtttctc
tggttatacaccagaattatagggttcaatccggctacagtagtcattaactctgagctt
ccatacgggtctggcctcggttcatcagcagctttatgtgtagctctcacagctgctctc
cttgcttcttctatttcagagaaaacccgtggtaacggttggtcatctctcgatgaaacc
aatcttgagttgctaaataaatgggctttcgaaggcgaaaagatcatccatgggaaacct
tctgggatagacaacaccgtcagtgcatacggcaacatgatcaagttctgctcaggcgag
ataactcggttacaatccaacatgcctctgagaatgctaattaccaacactagagttggg
cgaaacacaaaagctctggtctctggtgtgtcacagagagcggtaagacatcctgatgcg
atgaagtcagtgttcaacgccgtggattctataagcaaagagctcgctgcgatcattcag
tctaaagacgagacctcagttacagaaaaagaagagagaataaaagaactcatggagatg
aaccaaggtctgctcctgtcaatgggggttagccacagctcaatcgaggctgtgattcta
accacggtcaagcacaagcttgtctccaaacttacaggagctggtggcggcggctgcgtc
ctcactctattaccaaccgggacggtggtggacaaagtggtggaggagctcgagtccagc
ggttttcagtgtttcacggcattgattggtggtaacggagctcagatttgctattga

DBGET integrated database retrieval system