KEGG   Arabidopsis thaliana (thale cress): AT5G45900
Entry
AT5G45900         CDS       T00041                                 
Symbol
APG7
Name
(RefSeq) ThiF family protein
  KO
K08337  ubiquitin-like modifier-activating enzyme ATG7
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT5G45900 (APG7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G45900 (APG7)
   04121 Ubiquitin system [BR:ath04121]
    AT5G45900 (APG7)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT5G45900 (APG7)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    AT5G45900 (APG7)
   Atg8 conjugation proteins
    AT5G45900 (APG7)
Ubiquitin system [BR:ath04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   AT5G45900 (APG7)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT5G45900 (APG7)
SSDB
Motif
Pfam: ATG7_N ThiF Shikimate_DH rRNA_methylase
Other DBs
NCBI-GeneID: 834630
NCBI-ProteinID: NP_568652
TAIR: AT5G45900
UniProt: Q94CD5
Structure
LinkDB
Position
5:18615175..18618597
AA seq 697 aa
MAEKETPAIILQFAPLNSSVDEGFWHSFSSLKLDKLGIDDSPISITGFYGPCGHPQVSNH
LTLLSESLPLDEQSLIASTSHGNRNKCPVPGILYNTNTVESFNKLDKQSLLKAEANKIWE
DIQSGKALEDPSVLPRFLVISFADLKKWSFRYWFAFPAFVLDPPVSLIELKPASEYFSSE
EAESVSAACNDWRDSDLTTDVPFFLVSVSSDSKASIRHLKDLEACQGDHQKLLFGFYDPC
HLPSNPGWPLRNYLALIRSRWNLETVWFFCYRESRGFADLNLSLVGQASITLSSGESAET
VPNSVGWELNKGKRVPRSISLANSMDPTRLAVSAVDLNLKLMRWRALPSLNLNVLSSVKC
LLLGAGTLGCQVARTLMGWGIRNITFVDYGKVAMSNPVRQSLYNFEDCLGRGEFKAVAAV
KSLKQIFPAMETSGVVMAIPMPGHPISSQEEDSVLGDCKRLSELIESHDAVFLLTDTRES
RWLPSLLCANANKIAINAALGFDSYMVMRHGAGPTSLSDDMQNLDINKTNTQRLGCYFCN
DVVAPQDSMTDRTLDQQCTVTRPGLAPIAGALAVELLVGVLQHPLGINAKGDNSSLSNTG
NNDDSPLGILPHQIRGSVSQFSQITLLGQASNSCTACSETVISEYRERGNSFILEAINHP
TYLEDLTGLTELKKAANSFNLDWEDDDTDDDDVAVDL
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggctgagaaagaaactccagcaatcatacttcaattcgctccattgaacagttccgtc
gacgaaggtttctggcatagcttctcctctttgaaactcgacaaactcggaatcgatgat
tctccgatttcaatcaccggtttctatggaccatgtggacatccacaagtctcaaatcat
ttgactcttttatcagagtcattgcctttagatgaacaatcattgattgctagtactagt
catggaaataggaataagtgtcctgttcctgggattttgtataacaccaataccgttgaa
agcttcaataaacttgacaaacaaagtctgctaaaagcagaagcaaataagatttgggag
gatattcaatcaggaaaagctcttgaagacccttctgtgttaccaagattcctcgttatc
tcctttgcagaccttaagaaatggagttttcggtattggtttgcgttccctgcgtttgta
cttgatcctcctgtaagtttgattgaattaaagccagcttcagagtattttagttctgaa
gaggctgaatcagtatccgctgcttgtaatgattggcgcgactcagatttaactactgat
gttccattctttttggtttcggtttcttctgattcaaaagctagtatcagacatcttaaa
gacttggaagcgtgccaaggtgatcatcaaaagttgcttttcggtttctatgacccgtgt
caccttcctagtaatcctggctggccacttcgaaactacttggcactgattcgctcaaga
tggaacctcgagacagtttggttcttctgctacagagagagtcgtggtttcgctgacttg
aacctttctcttgttggtcaagcctcaattacactttcatcaggtgaatcagctgagact
gtacctaactcagtgggatgggagcttaacaaagggaaacgtgtaccccgatccattagc
cttgctaattccatggatccaacaaggttggctgtttctgctgtcgatttaaacttaaag
ttaatgagatggcgagcattaccgtctcttaacttaaatgtattgtcctctgtcaaatgc
cttcttcttggagctggtacattgggttgccaagttgctcgtacccttatgggttgggga
atccgcaatatcacctttgttgactatggaaaagttgccatgtctaatccagtcaggcaa
tctctctataattttgaagattgtctaggtcgtggtgagtttaaagctgttgctgctgtt
aaaagccttaaacagatatttccagcaatggaaactagtggagttgttatggctataccg
atgcccggacatccgatttctagccaagaagaagattctgttctcggtgattgtaaacgc
cttagcgagttgattgaatctcatgatgcggtgttcttgttaaccgatacaagagaaagc
aggtggttaccgtctcttctttgtgctaatgccaataagatcgctataaacgcggcttta
ggttttgacagctacatggtaatgcgccatggtgctggccccacctctctgtctgatgat
atgcagaatcttgacataaacaagacaaatacacagagacttggttgttacttctgcaac
gacgtggttgcacctcaggattcaatgactgatcgaactctagaccaacaatgcactgtt
acacgcccgggtctagctcctattgcaggagctctcgccgttgaactcttagtcggagtc
ctacaacacccacttggtatcaatgcaaaaggcgacaattcgagcttgagtaatacagga
aacaatgatgattcgcctctcgggatattacctcatcagatacgaggctcagtttctcag
ttctcacagatcacgctgcttggtcaagcttccaacagctgtaccgcttgctctgaaacc
gtgatatcggagtatagggagagaggaaacagtttcatacttgaagctattaaccatcct
acatacctggaggatcttactggtttaaccgagcttaagaaagctgctaattcattcaac
ctcgactgggaagacgatgatactgatgatgacgatgtagctgtagatctttaa

DBGET integrated database retrieval system