KEGG   Arabidopsis thaliana (thale cress): AT5G46330
Entry
AT5G46330         CDS       T00041                                 

Gene name
FLS2
Definition
(RefSeq) Leucine-rich receptor-like protein kinase family protein
  KO
K13420  LRR receptor-like serine/threonine-protein kinase FLS2 [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT5G46330 (FLS2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT5G46330 (FLS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT5G46330 (FLS2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT5G46330 (FLS2)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: TKL group
  IRAK family
   AT5G46330 (FLS2)
SSDB
Motif
Pfam: LRR_8 Pkinase LRR_4 PK_Tyr_Ser-Thr LRR_1 LRRNT_2 ABC1 LRR_5 FNIP LRR_6 TMEM154 Mid2 APH UPF0560 Rhabdo_glycop
Other DBs
NCBI-GeneID: 834676
NCBI-ProteinID: NP_001330009
MIPS: AT5G46330.1
TAIR: AT5G46330
UniProt: Q9FL28 C0LGU8
LinkDB
Structure
PDB: 
4MN8 4MNA

Position
5
AA seq 1173 aa
MKLLSKTFLILTLTFFFFGIALAKQSFEPEIEALKSFKNGISNDPLGVLSDWTIIGSLRH
CNWTGITCDSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLT
ELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNL
TGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLL
NLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKL
TSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLR
NLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQM
TGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQK
LRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLE
GPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSL
LNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNL
FSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGN
MTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGNT
DLCGSKKPLKPCTIKQKSSHFSKRTRVILIILGSAAALLLVLLLVLILTCCKKKEKKIEN
SSESSLPDLDSALKLKRFEPKELEQATDSFNSANIIGSSSLSTVYKGQLEDGTVIAVKVL
NLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHG
SAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTAR
ILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLN
DEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRP
EDRPDMNEILTHLMKLRGKANSFREDRNEDREV
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgaagttactctcaaagacctttttgatattaactctcaccttcttcttctttggcatt
gcactagcgaaacagagctttgaaccagagatcgaagctttgaaatccttcaagaatggt
atttccaacgaccctttaggagtattatcagattggaccatcatcggttcgttacgacac
tgtaattggaccggaatcacctgcgatagtaccggacatgtagtctcggtttccttgctg
gagaagcaacttgaaggtgttctgtctccagccatagcgaatctcacctatctccaggtt
cttgatctcacttcaaatagttttaccggcaaaataccggctgaaataggaaagttaacc
gagcttaaccagcttattctgtacctaaactatttctctggttcgattccttctggaatc
tgggagcttaagaatattttctatcttgatcttagaaataatttgttgtccggtgatgtt
cctgaggaaatctgcaaaaccagttctttggtattgattgggtttgattacaacaactta
accgggaaaataccagaatgcttaggagatttggttcatctccaaatgtttgtagcagct
ggtaaccatttaactggttcgattccggtatcaattggtactctggctaatttaacggat
ttagacctgagtggtaaccagttaaccggaaaaataccgagagattttggaaatctcttg
aacttacagtctctcgttttaactgaaaacttgttggaaggagatataccagctgagatc
ggaaactgctcgagcttggtccaacttgagctttacgataaccagttaaccgggaaaata
ccagctgaattagggaatttggttcagctgcaagcactccggatatacaagaacaaactt
acttcttcaattccatcttcattgttccggttaactcagttaacccatttggggttatca
gaaaaccatttggttggaccgatatcagaagaaatcggttttcttgagtcacttgaagtc
ctcacacttcattccaacaacttcacaggagagtttccacagtccatcacaaacttgagg
aacttgacagtcctaacggtggggttcaataatatttccggtgagctcccggcggatcta
gggcttcttacaaaccttcggaacctttcagcgcacgacaatcttcttaccggaccaata
ccttccagcataagtaactgcaccggtcttaaactcctggacctgtctcacaaccaaatg
actggcgagatcccgcggggtttcggaaggatgaatcttacgttcatttctattgggagg
aatcatttcaccggtgaaattccagatgatatcttcaactgttcaaacttggaaactctt
agtgtggcagataacaacttaacaggaactctcaagccattaattgggaagcttcaaaaa
ctcaggattttgcaagtttcatataactctctcactggaccgattcctcgagaaatcggg
aatctgaaagatttgaatatcttgtaccttcactctaatggtttcacagggagaatcccg
agagagatgtcgaatctcactctcctccaggggctaaggatgtattcaaatgatcttgaa
ggtccaattcctgaagaaatgtttgatatgaagctactctcagttcttgatctttccaac
aacaaattctcaggtcaaattcctgccttgttctccaagcttgaatcgcttacctacttg
agtcttcaaggaaacaaattcaacgggtctatccctgcaagccttaagtcgctttcgctt
ctcaacacattcgatatctccgacaatcttctcactggaaccatccctggagagctgtta
gcttctttgaaaaacatgcagctttacctcaacttctcaaacaacttgttgactggaacc
atcccaaaggagcttggaaagcttgaaatggttcaagaaatcgacctttcaaacaatctc
ttttctgggtctattccaagatctttacaggcctgcaaaaatgtgttcacactggatttt
tcgcagaacaatctctcgggtcatataccagatgaagtcttccaaggcatggatatgatc
ataagcttgaacctttcaaggaacagtttctctggagaaatccctcagagcttcgggaac
atgacgcatttggtctccttggatctctctagtaacaatctcactggtgaaattccagag
agtctcgccaatctttcgactctgaaacatctcaaactagcttcaaacaacctcaaaggc
catgttcctgaatccggggtgttcaaaaacatcaacgcctctgatctaatgggaaacaca
gatctctgtggtagcaagaagcctctcaagccatgtacgatcaagcagaagtcgagccac
ttctcgaagagaaccagagtcatcctgattattcttggatcagccgcggctcttcttctt
gtcctgcttcttgttctgattctaacctgttgcaagaaaaaagaaaaaaagattgaaaat
tcatcagagtcctcattaccggatttggattcagctctgaaactgaagagatttgaacca
aaagagttggagcaagcaacagattcattcaacagtgccaacatcattggctcaagcagc
ttaagcacagtgtacaaaggtcagctagaagatgggacagtgattgcagtaaaagtattg
aatctaaaggaattctctgcagaatcagacaagtggttctacacagaagctaaaacattg
agccaactaaaacatcgaaacctggtgaagatcttagggtttgcgtgggaaagcggcaaa
acgaaagctttagtgcttccatttatggagaatggaaacttggaggacaccattcacggc
tctgcagcaccgattgggtcgcttttagaaaaaatcgatctttgtgttcatatcgcaagc
ggaatcgattatcttcattctggatatggttttcccatcgttcattgtgatctgaagcca
gctaatatactccttgacagtgaccgcgttgctcacgtaagcgattttggaactgctcgg
attctaggtttccgcgaagatggaagcaccacagcttcaacatcagccttcgagggtaca
attggatacttagctccagagtttgcttatatgaggaaagtgacaacaaaagccgatgta
ttcagcttcgggatcataatgatggagctgatgacgaaacagagaccaacttcgttgaat
gatgaagattcacaagacatgactttgcgccaattggtggagaaatcgattggaaatgga
agaaaagggatggttagggttcttgatatggaactcggggactctattgtttctctgaaa
caggaagaggctattgaagactttctgaagctttgtttgttctgtacaagctctagacct
gaagatcgacctgatatgaacgagattcttacacatctgatgaaacttagaggcaaagcg
aattcatttcgagaagatcgtaacgaggatcgagaagtttag

DBGET integrated database retrieval system