KEGG   Arabidopsis thaliana (thale cress): AT5G50230
Entry
AT5G50230         CDS       T00041                                 
Name
(RefSeq) Transducin/WD40 repeat-like superfamily protein
  KO
K17890  autophagy-related protein 16-1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT5G50230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G50230
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT5G50230
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    AT5G50230
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    AT5G50230
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT5G50230
SSDB
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 NBCH_WD40 Nup160 PQQ_2 Cytochrom_D1 Crescentin HAP1_N
Other DBs
NCBI-GeneID: 835088
NCBI-ProteinID: NP_199834
TAIR: AT5G50230
UniProt: Q6NNP0
LinkDB
Position
5:complement(20448310..20451062)
AA seq 509 aa
MVQEEKAMEAINDALRALRKRHLLEEGAHAPAISALSKPLISQGSEWKEKTEKLETELQQ
CYKAQSRLSEQLVIEVAESRTSKAILQEKELLINDLQKELTQRREDCTRLQEELEEKTKT
VDVLIAENLEIRSQLEEMTSRVQKAETENKMLIDRWMLQKMQDAERLNEANDLYEEMLAK
LKANGLETLARQQVDGIVRRNEDGTDHFVESTIPSTCANRIHAHEGGCGSIVFEYNSGTL
FTGGQDRAVKMWDTNSGTLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGR
VRHTLTGHTDKVCAVDVSKFSSRHVVSAAYDRTIKLWDLHKGYCTNTVLFTSNCNAICLS
IDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHNVF
DTRTLEICGTLRASGNRLASNWSRSCISPDDDYVAAGSADGSVHVWSLSKGNIVSILKEQ
TSPILCCSWSGIGKPLASADKNGYVCTWT
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggtacaggaggagaaagctatggaagcaataaatgacgctttgagagctttgcggaag
cgtcatcttctggaagaaggagctcatgctcctgcgatttctgctctctctaagccttta
atctctcagggttcagaatggaaggagaaaacagaaaagctggaaacagagttacagcaa
tgttacaaagctcaatctcgactatctgaacaactggtgatagaagtagctgaatccaga
acttcaaaggctattttacaagagaaggagttgttaattaatgacttgcagaaggaatta
acacaaagaagggaggattgtacacgattacaagaagagttagaggaaaagaccaagacg
gtggatgtacttattgctgaaaacctggaaatacggtctcagttggaggagatgacaagt
agagtgcaaaaagcagagactgagaataaaatgttaattgatcggtggatgttgcagaag
atgcaggatgcagaacgtcttaatgaggcaaatgatctctatgaagaaatgctagctaag
ctgaaggcaaatggtttggaaactcttgctcggcagcaagttgatggtattgtccgccgc
aatgaagatggaaccgatcactttgttgagtcaaccattccgtcaacatgtgcgaatcgt
atccatgctcatgaaggtggctgtggttcaatagtctttgaatacaactctggtactctg
tttactggtgggcaagatcgagcagtaaaaatgtgggacaccaatagcggaactttaatc
aaaagcttatacggttcccttgggaatatacttgatatggccgtaacccacgacaataaa
tccgtgatcgcagcaaccagctcaaataatttgtttgtatgggatgttagctcgggtagg
gtacgccatacactcacaggccacacggataaggtttgtgctgtggatgtgagcaaattc
tctagccgacatgttgtcagtgcagcatatgaccgtaccataaaactttgggatttgcat
aaaggttactgcactaacacagtactctttaccagcaactgcaatgcaatctgcctcagc
atagatgggcttacggtattctcaggccacatggatgggaatcttaggttatgggatatt
caaactgggaaacttctgtccgaagtagctggacattcttctgctgtgacctcagtatca
ttgtcccggaacggaaataggatcttgacgagcgggagagacaacgtgcataatgtattt
gatacccggactttggaaatatgtgggacactgagagcatcggggaacagattagcatcg
aattggagccggtcatgcataagtccagatgatgattatgtggctgcgggatctgcagat
ggttcggttcatgtatggtcgctatctaaaggcaatatagtgagcattctcaaggagcaa
acatctcctatactgtgttgttcttggagtgggatcgggaaaccattggcatcggctgat
aaaaacgggtacgtttgtacgtggacatga

DBGET integrated database retrieval system