KEGG   Arabidopsis thaliana (thale cress): AT5G57360
Entry
AT5G57360         CDS       T00041                                 

Symbol
ZTL
Name
(RefSeq) Galactose oxidase/kelch repeat superfamily protein
  KO
K12115  clock-associated PAS protein ZTL
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G57360 (ZTL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT5G57360 (ZTL)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     AT5G57360 (ZTL)
SSDB
Motif
Pfam: Kelch_4 Kelch_3 Kelch_5 Kelch_2 Kelch_6 Kelch_1 PAS_9 F-box-like PAS F-box PAS_3 PAS_8 F-box_5
Other DBs
NCBI-GeneID: 835842
NCBI-ProteinID: NP_568855
TAIR: AT5G57360
UniProt: Q94BT6 A0A178UDC5
LinkDB
Structure
PDB: 
5SVV 5SVW 5SVG 5SVU

Position
5:23241320..23244590
AA seq 609 aa
MEWDSGSDLSADDASSLADDEEGGLFPGGGPIPYPVGNLLHTAPCGFVVTDAVEPDQPII
YVNTVFEMVTGYRAEEVLGGNCRFLQCRGPFAKRRHPLVDSMVVSEIRKCIDEGIEFQGE
LLNFRKDGSPLMNRLRLTPIYGDDDTITHIIGIQFFIETDIDLGPVLGSSTKEKSIDGIY
SALAAGERNVSRGMCGLFQLSDEVVSMKILSRLTPRDVASVSSVCRRLYVLTKNEDLWRR
VCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAAAWRKLSVGGSVEPSRCNFSACA
VGNRVVLFGGEGVNMQPMNDTFVLDLNSDYPEWQHVKVSSPPPGRWGHTLTCVNGSNLVV
FGGCGQQGLLNDVFVLNLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSG
VLLSDTFLLDLSIEKPVWREIPAAWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLKFRSS
DVFTMDLSEEEPCWRCVTGSGMPGAGNPGGVAPPPRLDHVAVNLPGGRILIFGGSVAGLH
SASQLYLLDPTEDKPTWRILNIPGRPPRFAWGHGTCVVGGTRAIVLGGQTGEEWMLSELH
ELSLASYLT
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggagtgggacagtggttccgatctaagcgccgatgatgcttcgtcactggcggatgat
gaagagggaggtctttttcccggaggtggaccaattccatatcccgttgggaatttgctt
cacacggcgccttgtggattcgttgttactgatgccgttgagccggaccaacctattata
tatgtcaacaccgtcttcgaaatggttacagggtatcgtgctgaggaagttctcggagga
aattgccgcttcttgcaatgtagaggaccgtttgctaaaagaaggcatccattagttgac
tctatggttgtttccgagataagaaaatgtattgatgagggcattgaatttcaaggcgag
ttgttgaactttaggaaagatggatctccgttgatgaatagattgcggttgactcctatt
tatggagacgatgatactattacccatataattggaatccagttctttatcgagacagac
attgaccttggacctgttcttggatcttcaacaaaagaaaagtcaattgatgggatatac
tcagctttagctgctggggagcggaatgtttcccgaggaatgtgtgggttattccagctg
agtgacgaggttgtgtctatgaagatattgtcacgcctgacaccaagagacgttgcatct
gttagctctgtgtgccgcaggctatatgtgctgacaaagaatgaggatctttggcgaagg
gtttgtcagaatgcatggggaagtgaaacaacacgggtattagagactgttcctggtgct
aaaagactcggttggggccgcttggctagagaactgaccacccttgaagctgcagcttgg
agaaaactttcggttggaggttctgttgagccttctcgctgtaattttagtgcttgtgct
gtcgggaacagagttgttctgtttggaggagaaggtgtgaatatgcagcctatgaatgat
acctttgttttagatctgaattctgattaccctgaatggcaacatgtcaaagtgagctcc
cctcctccaggacgctggggccacacgctcacttgtgtaaatggctccaatctggttgta
tttggtggctgtggtcagcaaggtttgctgaacgatgtgtttgtcttgaatctcgatgct
aagccgcctacttggagggaaatttcgggtttggctccgcctctaccaagatcatggcac
agctcatgcacccttgacggaaccaaactgatagtctctggaggctgtgcagattccggc
gttcttctaagtgacacgttcctcctcgacctttcaatagagaaaccagtgtggagagag
attccagctgcctggactccgccttcccggttaggccacacactatcggtttatggagga
agaaagatcttgatgtttggtggtcttgctaagagcgggcctttgaaattccgttcgagt
gatgtcttcacaatggatctaagcgaagaggagccttgttggaggtgtgtgaccggtagc
ggaatgcctggagcaggaaacccaggaggagtagcaccaccaccaaggctagatcacgtt
gcagttaacctccctggaggcagaatcttgatatttggcggctcagtggcagggcttcac
tcagcgtctcagctttatctacttgacccaacggaggacaaaccgacttggagaatacta
aacattccaggaagaccgcctcggtttgcttggggacatggcacttgtgttgtgggagga
acacgagcgatagtgctaggtggtcagaccggagaagaatggatgctaagtgagctacac
gaattatcactagcgagctatctcacgtaa

DBGET integrated database retrieval system