KEGG   Arabidopsis thaliana (thale cress): AT5G62430
Entry
AT5G62430         CDS       T00041                                 
Symbol
CDF1
Name
(RefSeq) cycling DOF factor 1
  KO
K16222  Dof zinc finger protein DOF5.5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G62430 (CDF1)
SSDB
Motif
Pfam: zf-Dof
Other DBs
NCBI-GeneID: 836364
NCBI-ProteinID: NP_201049
TAIR: AT5G62430
UniProt: Q8W1E3
LinkDB
Position
5:complement(25069093..25071111)
AA seq 298 aa
MLETKDPAIKLFGMKIPFPTVLEVADEEEEKNQNKTLTDQSEKDKTLKKPTKILPCPRCN
SMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKNKNNSPTSHYHHVTI
SETNGPVLSFSLGDDQKVSSNRFGNQKLVARIENNDERSNNNTSNGLNCFPGVSWPYTWN
PAFYPVYPYWSMPVLSSPVSSSPTSTLGKHSRDEDETVKQKQRNGSVLVPKTLRIDDPNE
AAKSSIWTTLGIKNEVMFNGFGSKKEVKLSNKEETETSLVLCANPAALSRSINFHEQM
NT seq 897 nt   +upstreamnt  +downstreamnt
atgctggaaactaaagatcctgcgataaagctctttggtatgaaaattcctttcccgacg
gttttagaggttgctgatgaagaagaagaaaagaaccaaaacaagacattaactgatcaa
tcggagaaagacaaaaccctaaagaaaccaaccaagattcttccatgtccaagatgcaac
agcatggagactaagttctgttactacaacaactacaacgtaaaccaacctcgccatttt
tgtaaagcttgtcagagatattggacctcaggtgggaccatgagaagtgttccaatcgga
gcaggacggcgcaagaacaagaacaactcaccaacttcacattaccaccatgtgactatc
tccgaaacaaatggtccggtccttagtttcagcctcggagatgatcaaaaggtctcgagt
aataggtttggtaatcaaaagctagttgctaggatagagaacaatgacgagcgctctaat
aacaacacttcgaacggtttgaattgttttccgggagtttcgtggccgtacacgtggaat
cctgcgttttacccggtttacccttattggagcatgccagtgttgtcttctccggtaagt
tcaagtcctacttctactcttggtaagcattcgagagacgaagacgagacggtgaagcaa
aaacagaggaatggatctgtattggttccaaagactttgagaattgatgatcctaatgaa
gctgcaaagagttcgatatggacaacacttgggatcaagaacgaagttatgttcaatggg
tttggttcgaagaaagaggttaagctcagtaacaaagaagaaacagagacctcacttgtt
ctttgtgcaaaccctgctgcgttatcaagatcaatcaatttccatgagcagatgtga

DBGET integrated database retrieval system