KEGG   Arabidopsis thaliana (thale cress): AT5G66930
Entry
AT5G66930         CDS       T00041                                 
Name
(RefSeq) meiotically up-regulated protein
  KO
K19730  autophagy-related protein 101
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT5G66930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G66930
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    AT5G66930
SSDB
Motif
Pfam: ATG101
Other DBs
NCBI-GeneID: 836827
NCBI-ProteinID: NP_569042
TAIR: AT5G66930
UniProt: F4K265 A0A654GFX2
LinkDB
Position
5:26725839..26727758
AA seq 215 aa
MNCEVCQLKELEVESFEIREVLRCILHTIVFHRALGLIRPKDIDLELFEITYVQCGEIEV
EKKIDEKIEQFINWIEKHPNKKSQICLSFYEVKSKQPSWFTKIERLYWEQWYINLNVLQP
TKPPVGKSHHSKLVMDPGEASEERSSRRTLLEQSLQEVLFQIIKFVNEKKDHVPPINDGV
IYYPFEITIPSSSDSAFGMDMFKRILHSGHPSMLG
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaattgcgaagtttgtcagctaaaggaactggaagtggaatccttcgagatacgcgaa
gttttgcgctgcattctacatacgattgtctttcatcgtgcgcttggtcttatccgccct
aaagatattgatttggagctttttgagatcacttatgtacaatgcggtgaaattgaagtg
gagaagaaaatcgatgaaaagattgagcagttcattaactggattgagaaacacccaaac
aaaaagagtcagatttgtctatcgttctatgaagtcaaaagcaaacagccttcttggttc
accaaaatcgaacggttgtactgggaacaatggtacatcaatctgaatgtgcttcagccc
actaagccccctgtcggaaagtctcaccattctaaactagttatggaccctggagaggca
tcggaggagagaagttctcgtaggacactgcttgagcaatcccttcaagaagtcttgttc
caaatcataaaattcgtgaatgagaagaaggatcatgttcctcccattaacgatggtgta
atctactacccttttgagatcactatcccaagctcatcggactctgcctttgggatggat
atgttcaagaggatactacacagtggccatccatcaatgctcggctaa

DBGET integrated database retrieval system