Arabidopsis thaliana (thale cress): DA397_mgp04 Help Entry DA397_mgp04       CDS       T00041                                  Symbol nad4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism ath  Arabidopsis thaliana (thale cress) Pathway ath00190   Oxidative phosphorylation ath01100   Metabolic pathways Module ath_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:ath00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DA397_mgp04 (nad4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ath03029]     DA397_mgp04 (nad4L) Enzymes [BR:ath01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      DA397_mgp04 (nad4L) Mitochondrial biogenesis [BR:ath03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     DA397_mgp04 (nad4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  36335703 NCBI-ProteinID:  YP_009472128 LinkDB All DBs Position MT:361637..361939 Genome browser AA seq 100 aa AA seqDB search MDLIKYFTFSMIIFILGIWGILLNRRNILIMLMSIELMLLAVNLNFLVFSVSLDDMMGQV FALLVLTVAAAESAIGLAIFVITFRVRGTIAVEFINSIQG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggatcttatcaaatatttcacattttctatgattatttctattttaggtattcgggga atcctccttaatagacgaaatattcctattatgtcaatgccaattgaatcaatgttatta gctgtgaattcgaactttttggtattttccgtttcttcggatgatatgatgggtcaagta tttgcttcattggttccaacggtggcagctgcggaatccgctattgggttagccattttc gttataactttccgagtccgaggtactattgctgtagaatttattaatagcattcaaggt taa

DBGET integrated database retrieval system