Atrimonas thermophila: M15_08460 Help Entry M15_08460         CDS       T10752                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism atho  Atrimonas thermophila Pathway atho01100   Metabolic pathways atho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:atho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M15_08460 (acpP)    00074 Mycolic acid biosynthesis     M15_08460 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M15_08460 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BER92102 LinkDB All DBs Position complement(829694..829927) Genome browser AA seq 77 aa AA seqDB search MDVFSKVKEIIVDQLGVDEDEVTPDASFIDDLGADSLDIVELIMAFEEEFDIDIPDEDAE KITTVGEAVEYIESKIS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggacgttttctccaaagtaaaagaaattattgtagaccagcttggtgttgatgaggac gaggtaactcccgatgcgtcctttatagatgatctgggcgcagattctctggacattgtg gagctcataatggcttttgaagaagaattcgacattgatatcccagacgaagacgcagaa aaaatcaccactgtcggagaggctgtagaatacatagaatccaaaatcagctga

DBGET integrated database retrieval system