Aliarcobacter thereius: ATH_0282 Help Entry ATH_0282          CDS       T07638                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism athr  Aliarcobacter thereius Pathway athr01100   Metabolic pathways athr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:athr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ATH_0282 (acpP)    00074 Mycolic acid biosynthesis     ATH_0282 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ATH_0282 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QBF15372 LinkDB All DBs Position complement(258951..259181) Genome browser AA seq 76 aa AA seqDB search MALFDDVKAVVVDQLDCDPAEVKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEEAE KILTVGDAISYIENNA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattatttgatgatgtaaaagcagtagttgtagatcaactagattgtgatccagca gaagtaaaagaggattcaaaatttattgaagatttaggggctgactctctagatgttgtt gagttagttatggctttagaagagaaattcgatattgaaattccagatgaagaagctgaa aaaatcttaactgttggtgatgctatatcatacattgaaaacaacgcataa

DBGET integrated database retrieval system